Data Loading...

KORAN SINDO -EDISI 22 MARET 2021 SINDIKAT NARKOBA TUNGGANGI PANDEMI Flipbook PDF

Dulu saya bekerja sebagaicheckin counter di bandara di Jakarta. Tapikarena Covid-19 saya jadi kerja begini.” Kalimat ter


120 Views
15 Downloads
FLIP PDF 12.62MB

DOWNLOAD FLIP

REPORT DMCA

SENIN 22 MARET 2021 Rp4.000 NO 5541 TAHUN KE 15

WASPADA LEDAKAN NARKOBA Barang bukti narkoba yang disita aparat hukum melonjak tajam, terutama dalam tiga bulan terakhir. Perlu kewaspadaan semua pihak dalam mengantisipasi potensi ledakan peredaran narkoba di masyarakat selama pandemi.

Perbandingan Barang Bukti 2020 dengan 2021 (Data Badan Narkotika Nasional)

DUGAAN PENYEBAB LONJAKAN NARKOBA DI MASA PANDEMI

Melonjaknya pengiriman paket melalui aplikasi daring.

sabu

Banyak penyalahgunaan akibat orang bekerja di rumah (WFH).

Hingga Maret 2021 sabu yang disita

808,67 KG (70,19%) Tahun 2020, total sabu yang disita 1.152,2 kg

ganja

Hingga Maret 2021 ganja yang disita

Diduga akibat melonggarnya pemeriksaan barang oleh aparat karena beralih fokus pada pengecekan kesehatan.

3.462,75 KG (143,64%) Tahun 2020, total ganja yang disita 2.410 kg

Jalur Penyelundupan Narkoba

“Dulu saya bekerja sebagai check in counter di bandara di Jakarta. Tapi karena Covid-19 saya jadi kerja begini.” Kalimat tersebut terlontar dari bibir YR, perempuan usia 44 tahun, pelaku pengedar narkoba yang ditangkap Satuan Reserse Kriminal Polrestabes Surabaya karena membawa 5 kg sabu-sabu dan 400 butir pil Hi Five.

NEGARA ASAL SINDIKAT PENYELUNDUP Sejumlah negara di Timur Tengah, Taiwan, Malaysia, dan China.

Saat dihadirkan pada gelar perkara di Mapolrestabes Surabaya, Senin (15/3) pekan lalu, perempuan yang beralamat di Pondok Pinang, Kebayoran Lama, Jakarta Selatan itu mengaku desakan ekonomi sebagai akibat tidak lagi bekerja membuatnya mau menerima tawaran sebagai pengedar narkoba. Rencananya YR akan membawa narkoba tersebut dari Surabaya ke Jakarta melalui jalur darat. Dia mengaku baru kenal empat bulan dengan orang yang memintanya mengantarkan barang haram tersebut ke Jakarta. “Belum dibicarakan (imbalan) karena saya ini baru pertama kali,” ujarnya.

Jenis Narkoba dan Efeknya

Methamphetamine atau sabu Paling banyak disalahgunakan, bekerja pada sistem saraf pusat dan sangat adiktif.

Ekstasi Obat sintesis yang dikenal karena efek halusinasi dan membuat bersemangat.

Kokain Serbuk putih yang sangat adiktif dan bisa memengaruhi sistem saraf pusat.

Website

www.koran-sindo.com

Talk Center (021) 3911518 082111989888 Terbit 16 halaman Harga berlangganan Rp87.000/bulan

Facebook

MNC KORAN SINDO

Heroin Bubuk putih atau cokelat dengan efek samping yang memicu orang sangat ketagihan dan sulit berhenti.

Me Tube

MNC KORAN SINDO

You Tube

Ganja Memicu sensasi sesaat dan perubahan pada tubuh, perasaan, pikiran, gerakan, dan ingatan.

MNC KORAN SINDO

YR hanya salah satu dari ribuan anggota jaringan pengedar narkoba yang ditangkap aparat selama masa pandemi. Kondisi pandemi diduga membuat banyak hal melonggar, termasuk pemeriksaan terhadap orang sehingga memicu meningkatnya peredaran narkoba. Peredaran narkoba naik signifikan selama setahun pandemi. Bahkan dalam tiga bulan ini, yakni sejak memasuki 2021, peredaran narkoba bisa disebut makin gilagilaan. Hal itu tergambar dari barang bukti yang disita Badan Nasional Narkotika (BNN). Kepala BNN Irjen Pol Petrus Reinhard Golose saat rapat dengan Komisi III DPR pada Kamis (18/3) membeberkan, dalam tiga bulan terakhir, yakni hingga Maret 2021, barang bukti sabu yang disita BNN sudah mencapai 808,67 kg. Jumlah ini setara dengan 70,19% dari total barang bukti sabu yang disita selama setahun pada 2020, yakni sebanyak 1.152,2 kg. ------------------------KE HAL 4

Twitter

@MNCKORAN SINDO

Google Plus

Instagram

MNC KORAN SINDO

@KORANSINDO

Peredaran Narkoba Naik saat Wabah Melanda Pemberantasan narkoba di Indonesia kian menghadapi tantangan ekstraberat. Di saat wabah korona melanda, angka persebaran barang haram ini justru meningkat tajam. Kenaikan tinggi antara lain pada penggunaan sabu-sabu dan tembakau gorila.

TOPIK PILIHAN

3

Baca juga halaman 2

Selamatkan Anak dari Bahaya Laten Narkoba

INFOGRAFIS: KORAN SINDO/WIN CAHYONO

n Melalui perairan laut, terutama Pantai Timur Pulau Sumatera. n Melalui udara melalui bandara internasional di Indonesia. n Melalui jalur darat, terutama wilayah perbatasan Indonesia dan Malaysia.

QUOTe OF THE DAY

KORAN SINDO

GOLD CHAMPION KATEGORI NEWSPAPER

THE BEST NATIONAL NEWSPAPER GOLD WINNER IPMA-IYRA 2018

"Pada tanah yang sama kita berdiri, pada air yang sama kita berjanji, karena darah yang sama jangan bertengkar, karena tulang yang sama usah berpencar."

IwAN FALS PeNyANyI

2

SENIN 22 MARET 2021

BeritA utama

Selamatkan Anak dari Bahaya Laten Narkoba JAKARTA - Sekarang ini bahaya laten narkotika dan obat-obatan terlarang (narkoba) tidak hanya dialami orang dewasa, tetapi juga sudah menjamah anak-anak. Narkoba dengan mudahnya merasuk ke dunia anak terlebih jika tidak ada upaya dari masyarakat untuk sama-sama saling menjaga dan melindungi masa depan anak-anak Indonesia dari zat memabukkan ini. Di situasi pandemi, meskipun anak belajar di rumah, namun jika orang tua tidak memiliki kecakapan mengasuh, tentu anak-anak akan menjadi sangat rentan terjerumus. Semua pihak, mulai dari orang tua di rumah, juga guru tetap harus memperingatkan anak- anak didiknya. Mengenalkan bahaya narkoba, apa dampaknya, hukumannya yang berat, juga masa depan yang akan rusak jika sudah mulai mencoba narkoba. Celakanya, berkembang pandangan keliru di masyarakat, jika ada kerabat terdekat atau keluarga yang terjerumus narkoba, baru terasa jahatnya barang haram tersebut. Bila tidak ada kasus narkoba di lingkungan terdekat, masyarakat merasa narkoba jauh dari mereka, narkoba tidak nyata. “Tokoh agama pun penting untuk menyuarakan ini (bahaya narkoba). Jangan sampai kemudian terkena dulu, sudah terlambat. Para influencer yang peduli nasib anak bangsa untuk dapat memberikan insight positif untuk selalu jauhi narkoba,” ujar Sekjen Komisi Perlindungan Anak Indonesia (KPAI) Rita Pranawati. Anak menjadi kurir narkoba, ujar Rita, juga menjadi masalah serius lama yang harus ditangani secara tuntas. Meskipun tidak menjadi pengguna, namun mereka sudah dekat dengan lingkaran narkoba. Tidak mustahil, ke depannya mereka akan ikut menikmati. Anak menjadi kurir narkoba ini terjadi karena cara berpikir mereka yang instan. Mereka ingin mendapat sesuatu dengan cara cepat, maka mau melakukan apa saja untuk mendapatkan apa yang diinginkan. Perkenalan dengan narkoba banyak muasalnya, bisa dari teman dekat, lingkungan, juga jejaring online. Maka, penting untuk melakukan upaya optimal dari sekolah secara terus menerus. Guru harus menyadari, ancaman narkoba ini serius dan menjadi tugas mereka untuk selalu mengingatkan. Guru mampu mengomunikasikan bahaya narkoba dengan bahasa sesuai dengan usia, tidak menggurui, tetapi informatif dan menggunakan media yang anak sukai.

ba. Tidak lupa pula untuk terus mengingatkan para perangkat pemerintah dan aparat untuk selalu menyosialisasikan bahaya narkoba dan mengajak masyarakat untuk saling menjaga. Meski hal ini menjadi bagian yang sulit, tetapi harus terus dilakukan semua pihak. Masyarakat harus semakin peduli jika di lingkungan mereka ada transaksi narkoba atau menemukan

rialistik, tak jarang orang tua tega mengorbankan anaknya menjadi kurir narkoba. Rita mencontohkan kasus seorang anak yang menjadi kurir narkoba dan kini tengah ditangani Lembaga Pembinaan Khusus Anak (LPKA) Tanjung Balai, Medan, Sumatera Utara. Dalam pengakuannya, si anak membawa 510 kg narkoba, mendapat imbalan Rp10 juta. Kalau bawa kelipatannya, juga bisa lebih dari Rp20 juta. “Niat mereka mulia, membantu keluarga (dengan berjualan narkoba). Mentalitas seperti ini yang harus diubah. Me-

Perkuat Ketahanan Sosial

Wakil Ketua Komisi VIII DPR Rieke Diah Pitaloka mengatakan, narkoba merupakan salah satu persoalan sosial yang memerlukan perhatian dari seluruh lapisan masyarakat dan pemerintah. Peningkatan penyalahgunaan narkoba di kalangan anak-anak bukan semata-mata akibat kurangnya pendidikan internal keluarga, tapi akibat kurangnya pembinaan lingkungan sosial.

dorong untuk melakukan pengawasan dan perhatian terhadap lingkungan dan anak-anak didiknya, juga lebih giat menyosialisasikan bahaya narkoba. Diah mengaku prihatin dengan meningkatnya penyalahgunaan narkoba di kalangan anak-anak selama pandemi Covid-19. Peningkatan ini menunjukkan perdagangan narkoba terus berjalan meski diterapkan pembatasan aktivitas sosial. “Kalau satu orang sudah kecanduan, teman-temannya yang lain bukantidakmungkinjuga

Tanggung Jawab Semua Pihak Sejatinya, anak perlu diberi pemahaman sekaligus penyadaran mengenai bahaya laten narkoba. Dampak bagi mereka di masa depan. Kesehatan sudah pasti terganggu dan juga akan mengubah perilaku mereka. Karena jika sudah kecanduan, nantinya anak akan melakukan apa pun termasuk mencuri atau melakukan tindak pidana yang lain. Bahkan menjual barang-barang milik orang tua. Dimulai dari barang kecil seperti panci, nanti lama kelamaan bisa barang yang besar. “Secara sosial (anak yang terjerumus narkoba) tentu akan berdampak. Sumber daya manusia (SDM) yang menjadi aset bangsa ini akan dirugikan. Ketika sudah terpapar maka secara sosial anak tidak berdaya, tidak memiliki kepribadian yang baik dan dapat bersosialisasi. Kendala juga dirasakan saat mengenyam pendidikan. Maka sangat benar jika yang akan terancam adalah SDM Indonesia,” tutur Rita. KPAI menyarankan kepada pemerintah untuk gencar melakukan peer to peer counseling. Anak-anak muda senangnya mencontoh, maka perlu direkrut banyak duta pencegahan narko-

anak-anak muda yang berkelompok. Masyarakat harus skeptis untuk selalu mencurigai aktivitas yang tidak biasa. Rita pun memastikan, upaya pencegahan dan penindakan menyangkut penyalahgunaan narkoba pada anak akan terus dilakukan KPAI. Jika ada anak ter jerat hukum akibat narkoba, secara umum KPAI melakukan pengawasan dan memastikan hak anak yang mendapatkan sanksi hukum dilakukan oleh pengadilan anak. “Kami tetap mendorong untuk mengadili pelaku sesungguhnya yang menjadi otak kasus penyalahgunaan narkoba pada anak. Jangan sampai ada anak dimanfaatkan, ini menjadi prioritas kami,” ujarnya. Bahkan, KPAI juga akan melindungi anak-anak dari orang tua yang malah menjerumuskan anak ke dalam lingkaran setan narkoba. Akibat terlalu mate-

nyadarkan mereka bahwa tindakannya ini merusak masa depan diri dan bangsa. Begitupun sikap orang tua yang meyakini anak mereka tidak akan menjadi pengguna, dan mengatakan kalau ketangkep berarti sedang tidak beruntung. Itu hal yang salah. Masyarakat jangan beri celah pada narkoba. Pendidikan yang baik dari keluarga agar anak-anak mereka bisa hidup lebih baik, itulah konsep hidup etika agama yang harus diajarkan orang tua sedari dini pada anak,” pungkas Rita.

“Kebanyakan kan anak-anak mendapatkan narkoba di lingkungannya. Tantangannya adalah bagaimana kita menjaga lingkungan sosial kita. Setidaknya harus ada pengawasan sosial dan memperkuat ketahanan lingkungan sosial, baik dari pemerintah daerah, kelurahan, desa, RT/RW, atau tokoh (agama dan masyarakat). Ketahanan sosial ini harus dibangun menjadi bagian dari kehidupan,” ucap Diah Pitaloka. Lembaga pendidikan dan guru juga di-

akan ikutikutan mencoba. Anakanak juga awalnya bisa saja tidak tahu kalau itu adalah narkoba. Karena itu, semua pihak harus memerhatikan kondisi lingkungan sosial. Ini penting dan perlu didengungkan di tingkat nasional sebab kondisinya memang memprihatinkan,” kata Diah. Diah melanjutkan, isu penyalahgunaan narkoba memerlukan pengawasan dan pencegahan di hulu dan pembinaan serta penanganan secara tuntas di hilir. Pengawasan perdagangan narkoba dari luar negeri juga perlu diperketat. “Sebisa mungkin barang narkoba tidak boleh masuk ke Tanah Air,” tegasnya. p ananda nararya/muh shamil

Kenalkan sejak Dini, Keluarga dan Sekolah jadi Penentu PSIKOLOG Anggia Chrisanti dari Biro Psikologi Westaria juga menegaskan bahwa narkoba menjadi musuh bersama. Karena itu, kata dia, setiap lembaga negara harus memiliki program penanggulangannarkobaterutama bagi generasi muda. Namun, bukan hanya program penanggulangan narkoba yang digalakkan, tetapi ada hal yang lebih penting agar anak jauh dari pengaruh buruk di lingkungan mereka. Dimulaidaribagaimanaterciptanyakeluargapositifdengankomunikasi yang baik. Hubungan kelekatan antarsetiap anggota keluarga menjadi faktor paling penting. Apalagi, pada kenyataannya 85%

pengguna narkoba dari mulai yang coba- coba sampai yang sudah lama disebabkan oleh adanya masalah dari diri pribadi atau permasalahan dari rumah. “Mengapaseoranganakingin mencoba-coba, secara teori 85% disebabkan oleh lingkungan keluargayangtidakkondusif.Negara memang bertanggung jawab melindungi generasi muda dari bahaya narkoba. Namun, keluarga, komponen terkecil dalam sebuah negara menjadi faktor utama. Peran orang tua membentuk dan mengembangkan potensi anak berdasarkan fitrah. Kalau ini bisa tercapai, perasaan negatif baik yang dirasakan anak mau-

pun orang tua akan terminimalisir. Jangan lupa untuk cepat menyelesaikan masalah, jangan menunggu sampai lama. Karena tidak pernah ada masalah yang benar-benar menguap terbang begitu saja,” tutur Anggia. Menurut Anggia, jika ada sedikit saja perasaan sedih, marah, malu, curiga, sakit hati yang dialami seorang anak, semua perasaan tadi akan menjadi pilihan untuk kemudian dilampiaskan ke perilaku buruk, atau disimpan di alam bawah sadar yang bagaimanapun juga akan muncul dalam bentuk lain yang cenderung negatif. Jika dihubungkan dengan narkoba, ini

merupakan perilaku menyimpang dari keumuman yang dihasilkan dari emosi negatif. Sesuai teori pembentukan perilaku, perilaku terbentuk dari pemahaman. Ketika pemahamannya diubah menjadi positif, perilakunya akan positif juga. “Edukasi ke anak untuk hatihati terhadap narkoba dalam berbagai bentuk, ini tidak ada yang tiba-tiba. Faktor pengasuhan sedari kecil bisa memengaruhi. Biasakan anak-anak untuk mengungkapkan perasaan tidak nyaman atau hal negatif, baik yang dialami di rumah, sekolah atau dari teman. Ketika anak sudah menyadari bahwa

perasaan itu boleh untuk diungkapkan, biasanya yang seperti itu tidak akan mudah terpengaruh diajak teman untuk mencoba hal negatif,” tuturnya. Anggia berpesan kepada orang tua maupun guru untuk menjadikan anak sebagai dirinya sendiri. Kalau anak bisa menjadi dirinya sendiri, dengan sendirinya anak tidak bisa dipengaruhi oleh orang lain. Khusus kepada pihak sekolah, lanjut Anggia, punya andil besar memberikan pemahaman akan bahaya narkoba kepada anak. Berbagai sosialisasi perlu dilakukan, jangan lupa pendekatan lain yakni motivasi kepada anak

bahwa mereka tidak akan bisa dipengaruhi oleh narkoba. “Berikan kata-kata positif seperti sayangi tubuh kamu, kamu kuat tidak mungkin narkoba bisa masuk ke tubuh kamu. Nanti orang yang menyayangi tubuhnya, dia akan tahu itu tidak baik untuk tubuhnya,” ungkapnya. Sosialisasi dengan memberi tahu nama-nama narkoba, jenisjenisnyadancaramenggunakannya perlu disampaikan kepada anak.Sebab,jikatidakdiberitahu sejak dini, nanti ketika anak sedang merasa tidak mendapat kasih sayang, keinginannya tidak terpenuhi atau bermasalah dengan keluarga, malah membuat

rasa penasaran dan akhirnya mencoba narkoba. “Beri tahu efek mengonsumsi narkoba. Secara psikologis bukan ketergantungan, tapi tidak berdaya sehingga seorang anak tidak bisa melakukan apa yang ia harus lakukan. Kalau seorang anak pada usia tertentu sudah tahu dirinya tidak berdaya jika sudah terkena narkoba, bagaimana selanjutnya kita beri tahu dia akan dipermainkan (diperbudak oleh narkoba). Jadi, efeknya itu secara psikologis, ia tidak mampu melakukan potensi yang dimiliki, cara berpikirnya pun sudah tidak lagi maksimal,” tandasnya. p ananda nararya

3

SENIN 22 MARET 2021

berita utama

NARKOBA Tak Surut Dihantam KORONA Pandemi merontokkan semua sendi kehidupan manusia di berbagai belahan dunia. Namun tidak demikian dengan peredaran dan kasus narkoba di Indonesia yang ternyata ‘kebal’ dari pandemi dan justru mengalami peningkatan. Seperti halnya di bidang lain, peredaran narkoba juga mengalami adaptasi dan modus baru di tengah Covid-19. Hal inilah yang membuat peredaran narkoba di Tanah Air sampai sejauh ini masih menjadi persoalan akut dan seolah tak pernah bisa diberantas hingga ke akar-akarnya.

NARKOBA TERBANYAK DIGUNAKAN DI MASA PANDEMI

1

sabu-sabu naik

PREVALENSI PENGGUNA NARKOBA SETAHUN TERAKHIR Prevalensi atau penduduk Indonesia yang mengonsumsi narkotika menurun 0,6% dalam tiga tahun terakhir, yakni dari 4,53 juta ke 3,41 juta. Namun, dalam setahun terakhir, ada kenaikan 0,03%.

narkoba

Sepanjang tahun 2020, diperkirakan ada 18 jenis narkoba yang masuk ke Indonesia

6

2

50% atau sekitar

125.000

7 JARINGAN NARKOBA YANG BEROPERASI DI INDONESIA SELAMA 2020

98jaringan, 27di antaranya

internasional

Selama 2020, BNN menemukan ada da 98 jaringan narkotika, 27 di antaranya nya berskala internasional. Dari jumlah tersebut, terdapat 33 jaringan telah diungkap dan 19 di antaranya melibatkan warga binaan lapas.

PEREDARAN NARKOBA DI INDONESIA BERDASAR RUTE

80% lewat jalur laut

3

JUMLAH NAPI KASUS NARKOBA DI LAPAS INDONESIA

INFO GRAFIS: KORAN SINDO/BOBBY FIRMANSYAH

Sabu paling banyak digunakan terutama saat pandemi Covid-19. Jika ada 2019 peredaran narkoba jenis sabu-sabu mencapai 2,7 ton, tahun 2020 meningkat 119% menjadi 5,91 ton.

NARKOBA YANG MASUK KE INDONESIA SEPANJANG 2020

86 jenis

Selain sabu, peredaran tembakau gorilla selama pandemi juga naik. Tercatat pada 2019, jumlah peredaran tembakau gorila sebanyak 12,92 kg, sedangkan pada 2020 mencapai 139,92 kg.

119% dibanding 2019

naik 0,03%

5

RUTE BARU PEREDARAN NARKOBA LEWAT LAUT MASA PANDEMI

Iran, Afghanistan, Malaysia-pantai timur Sumatera, Kalimantan Utara

8

Selama masa pandemi Covid 19, BNN mendeteksi rute baru peredaran narkotika lewat laut. Ada rute baru dari Iran, Afghanistan, juga Malaysia-pantai timur Sumatera dan Kalimantan Utara yang menjadi bagian wilayah Malaysia.

JUMLAH PENGUNGKAPAN KASUS NARKOBA OLEH POLRI SELAMA 2020

4

Menurut data BNN, sekitar 80% peredaran narkotika ka di Indonesia, menggunakan jalur laut.

Saat ini sekitar 125.000 atau 50% penghuni lapas adalah mereka yang divonis bersalah karena masalah narkotika. Dari jumlah itu, 43.000 adalah pengguna, sedangkan yang lainnya adalah pengedar.

33.860 kasus sumber: diolah dari berbagai sumber

Sepanjang 2020, Polri tercatat telah menuntaskan 33.860 kasus narkoba dari 38.292 kasus di tahun 2020 atau sebesar 88% penyelesaian perkara. Polri berhasil menyita barang bukti 50,1 ton ganja, 5,53 ton sabu-sabu, 737.384 butir ekstasi, 41.765 gram heroin, 330 gram kokain dan 104.321 gram tembakau gorila.

4

SENIN 22 MARET 2021

beRiTa utama Festival Cahaya Noor Riyadh

REUTERS / AhmEd YoSRi

(Foto searah jarum jam) Pengunjung mengabadikan instalasi lampu warna-warni yang menghiasi ruang publik pada ajang festival cahaya dan seni bertajuk Noor Riyadh di Riyadh, Arab Saudi, akhir pekan lalu. Beragam instalasi cahaya ditampilkan untuk pertama kalinya. Instalasi megah yang dipamerkan di seluruh kota mencakup patung, proyeksi, pertunjukan interaktif, dan permainan cahaya menghiasi ruang publik hingga Sabtu (3/4).

Sindikat Narkoba Tunggangi Pandemi (( dari Hal 1 Demikian juga barang bukti ganja. Hingga Maret 2021 telah disita sebanyak 3.462,75 kg ganja atau meningkat 143,64% bila dibandingkan dengan barang bukti selama setahun pada 2020, yakni sebanyak 2.410 kg. Jumlah barang bukti tersebut, menurut dia, hanya yang disita BNN, belum termasuk yang disita aparat Bea Cukai dan Polri. Pengawasan Longgar akibat Pandemi Meningkatnya peredaran narkoba di masa pandemi ditengarai dipicu oleh banyaknya penyelundupan yang lolos sebagai akibat longgarnya pemeriksaan aparat. Pakar politik dan keamanan yang juga guru besar Universitas Padjadjaran Muradi mengatakan, dalam setahun ini memang upaya aparat lebih banyak untuk mendukung gerakan meminimalkan penyebaran Covid-19. “Bahwa ada orang yang pakai narkoba karena banyak tinggal di rumah selama pandemi, bisa jadi iya, itu satu sisi. Tapi di sisi lain sayamelihatnyainiakibatadanya kelonggaran,” ujarnya kepada KORAN SINDO , Sabtu (20/3). Dia mencontohkan kasus ketika orang melakukan perjalanan menggunakan jalur darat. Saat pemeriksaan oleh aparat hukum di jalan, fokus bukan pada isi dari barang yang dibawa seseorang, melainkan pada orangnya -dalam hal ini untuk mengantisipasi penyebar luasan pandemi Covid-19. Padahal, sebelum pandemi, barang bawaan bisa dibongkar bahkan diacak-acak oleh petugas demi memastikan tidak ada narkoba. Pemeriksaan terhadap barang pun juga cenderung dihindari karena meminimalkan potensi penularan virus. Kondisi lengah inilah yang dimanfaatkan jejaring narkoba. “Fokus aparat dalam mencegah peredaran narkoba perlu dinormalkan kembali, memeriksanya harus kembali seperti dulu lagi. Karena hanya dengan cara itu distribusi narkoba akan terputus,” ujarnya. Selain itu Muradi juga menengarai maraknya peredaran narkoba akibat dari meningkatnya pengiriman paket atau jasa layanan pengantaran logistik

selama pandemi. Misalnya, kalau ada pengantaran lalu ditanya apa isinya, bisa saja misalnya pengirim mengatakan kalau itu untuk antigen test , padahal ternyata di dalamnya ada bahan baku sabu atau bahan baku ekstasi. Hal lain yang juga membuat peredaran narkoba lebih rawan adalah tersedianya fasilitas seperti executive lounge yang sifatnya private dan bisa disewa dua atau tiga jam untuk rapat dan sebagainya. Menurut dia, transaksi bisa saja terjadi di tempat private seperti itu. “Jadi kondisi pandemi memang membuat peredaran lebih mudah. Aparat perlu lebih intensif lagi dalam penegakan hukum,” katanya mengingatkan. Dia menegaskan bahwa kasus meningkatnya peredaran narkoba di masa pandemi ini bukan karena aparat kalah, tetapi lebih ke soal fokusnya yang kini lebih diarahkan untuk antisipasi penyebaran Covid19. Untuk itu dia meminta agar fokus pengamanan dibagi. “Jangan semua fokusnya ke situ (Covid-19), perlu juga ke hal yang lain, termasuk narkoba dan penyelundupan barang lain yang dulunya dilarang bisa saja sekarang marak,” tandasnya. Laut Jalur Favorit Penyelundupan Direktur Tindak Pidana Narkoba Bareskrim Polri Brigjen Pol Krisno H Siregar mengungkapkan jumlah kasus peredaran narkoba selama pandemi sebenarnya tidak meningkat, bahkan sebaliknya menurun bila dibandingkan dengan tahun sebelumnya. Namun jumlah barang bukti narkotika, khususnya jenis methampetamine (sabu), memang terjadi peningkatan signifikan selama masa pandemi Covid-19. Dia tidak menyebutkan lebih terperinci faktor pemicu kenaikan peredaran narkotika jenis sabu tersebut. Namun pihaknya terus meningkatkan deteksi terhadap peredaran dan penyelundupanzatadiktifmelaluiberbagai pintu masuk seperti wilayah perbatasan, perairan laut, bandara. Krisno menuturkan, penyelundupan paling banyak dilakukanparasindikatmelaluiperairan laut. Para sindikat meman-

Pemimpin Umum: Hary Tanoesoedibjo Wakil Pemimpin Umum/Pemimpin Perusahaan: Sururi Alfaruq Pemimpin Redaksi /Penanggungjawab: Djaka Susila Wakil Pemimpin Redaksi: Dwi Sasongko, Hanna Farhana Fauzie Redaktur Pelaksana: Alex Aji Saputra, Abdul Hakim Wakil Redaktur Pelaksana: Armydian Kurniawan, Yanto Kusdiantono, Anton Chrisbiyanto, Hatim Varabi Redaktur: Agung Nugroho BS, Alviana Harmayani Masrifah, Bakti M Munir, Boy Iskandar, Danang Arradian, Edi Purwanto, Ma’ruf, M Iqbal, Mohammad Ridwan, Mohammad Faizal, Puguh Hariyanto, Shalahuddin, Sujoni, Sunu Hastoro Fahrurozi, Suwarno, Syahrir Rasyid, Vitrianda Hilba Siregar, Wuri Hardiastuti Asisten Redaktur: Abdul Rochim, Abriandi, Adam Prawira, Andika Hendra Mustakim, Donatus Nador, Herita Endriana, Hendri Irawan, M Purwadi, M Yamin, Nuriwan Tri Hendrawan, Rakhmat Baihaqi, Rarasati Syarief, Rusman Hidayat Siregar, Sali Pawiatan, Sazili Mustofa, Sucipto, Sudarsono, Syarifudin, Thomas Pulungan, Titi Sutinah Apridawaty, Wasis Wibowo, Wahyu Sahala Tua, Wahyono

faatkanwilayahperairanlantaran Indonesia memiliki garis pantai panjang. Terlebih lagi belum semua perairan mampu diawasi otoritas negara dengan baik. Salah satu yang menjadi zona merah penyelundupan narkoba adalah perbatasan laut Pantai Timur Pulau Sumatera. Jaringan internasional ini datang dari berbagai negara, di antaranya dari kawasan Timur Tengah, Taiwan, Malaysia, China. Semua sindikat internasional tersebut berkolaborasi dengan jaringan di Indonesia seperti di Aceh, Madura, Padang, Medan, Surabaya, Palembang. Umumnya mafia itu merekrut nelayanlokalyangditugasisebagai pengantar(transporter). “Maritime route menjadi jalur favorit yang digunakan sindikat kejahatan untuk memasukkan narkoba dalam jumlah besar ke Indonesia karena panjangnya garispantainegarakita.Tapi,saya kira kelemahan bukan hanya disebabkan faktor personel yang kurang tetapi juga peralatan modern seperti kapal patroli, alat deteksi, dan lainnya,” paparnya. Krisno menandaskan, Polri tidak bisa bekerja sendiri dalam mengawasi banyaknya celah dan modus operandi yang digunakan para sindikat. Khusus di jalur laut, Direktorat Tindak Pidana Narkoba (Dittipidnarkoba) Bareskrim Polri secara internal bersinergi dengan Ditpolair Baharkam Polri. Selain itu bekerja sama dengan TNI Angkatan Laut, Badan Keamanan Laut (Bakamla), serta Direktorat Jenderal Bea dan Cukai Kementerian Keuangan. Perang terhadap narkoba belum akan berakhir dan tantangan yang dihadapi aparat hukum di masa depan juga tidaklah mudah. Krisno pun mengakui kemajuan teknologi dan transportasi saat ini telah berdampak terhadap perkembangan modus operandi kejahatan, termasuk peredaran gelap narkoba melalui jalur daring (online ). Dittipidnarkoba Bareskrim Polri disebutnya harus mampu memprediksidalamrangkamengantisipasi dinamika ancaman kejahatansehinggatidakhanyamenjadi“pemadamkebakaran”. pbakti munir/ faorick pakpahan

Jalur Tikus Sasaran Penyelundupan MENINGKATNYA peredaran narkoba selama masa pandemi diduga tak lepas dari banyaknya pengiriman narkoba yang masuk melewati titik perbatasan. Di antara jalur penyelundupan, Entikong, Kalimantan Barat, menjadi wilayah perbatasan Indonesia dan Malaysia yang paling diincar sindikat. Salah satu penyelundupan yang berhasil digagalkan melibatkan seorang pekerja migran Indonesia (PMI) yang bekerja di Malaysia. Berdasar keterangan pihak Bea Cukai setempat, pemuda tersebut menyelundupkan 18 kg sabu-sabu ke dalam sebuah koper melalui Pos Lintas Batas Negara (PLBN) Entikong di Kabupaten Sambas. Pelaku yang ditangkap pada Februari 2021 itu mengaku mendapat upah 10.000 ringgit atau sekitar Rp35 juta dari seorang bandar di Malaysia. Para penyelundup kerap memanfaatkan para pekerja Indonesia yang pulang ke Indonesia untuk membawa barang haram. Narkotika dimasukkan melalui jalur resmi, yakni melalui PLBN, maupun tidak resmi berupa jalan pintas atau jalur tikus yang banyak terdapat di perbatasan. Dosen Fakultas Ilmu Sosial dan Ilmu Pendidikan (Fisip) Universitas Tanjungpura (Untan), Pontianak, Elyta yang melakukan riset di Entikong menyebut penggunaan jalur tikus jadi salah satu sebab mengapa penyelundupan di perbatasan masih sulit dihilangkan. Modus penyelundupan melalui jalan tikus sebagian masih dengan cara lama, yakni membawa barang yang di dalamnya telah disembunyikan narkoba. “Selain itu, ada modus baru, salah satunya menggunakan rute yang dengan skema estafet, bergantian. Tidak hanya menggunakan kendaraan saja, melainkan juga kerap berjalan kaki,” ujarnya. Elyta meneliti penyelundupan narkoba di perbatasan menggunakan teori Cross Border Crime dan metode deskriptif dengan pendekatan kualitatif. Data penelitian diperoleh melalui wawancara dan studi literatur. Hasil riset yang sudah dipublikasikan melalui jurnal pada November 2020 ini menemukan enam kelemahan yang menjadi penyebab sulitnya menanggulangi penyelun-

Reporter: Abdullah M Surjaya, Alimansyah Harphianto, Bima Setiyadi, Binti Mufarida, Dyah Ayu Pamela, Dita Angga, Dian Ramdhani, Haryudi, Hasan Kurniawan, Helmi Syarif, Hafid Fuad, Heru Febrianto, Ichsan Amin, Iman Firmansyah, Inda Susanti, Kiswondari, Kunthi Fahmar Sandy, Muh Shamil, Mula Akmal, Neneng Zubaidah, Oktiani Endarwati, Raikhul Amar, R Ratna Purnama, Rendra Hanggara, Sabir Laluhu, Sri Noviarni, Susi Susanti, Teguh Mahardika, Thomas Manggalla, Yan Yusuf, Nanang Wijayanto Sumatera Utara: Zailani Tanjung Sumatera Selatan: Berli Zulkanedi Jawa Barat: Agus Warsudi, Khusnul Huda, Adi Haryanto, Agung Bakti Sarasa, Arif Budianto, Asep Supiandi JawaTengah: Ahmad Antoni, M Fauzi Miftah, Angga Rosa, Ary Wahyu W Yogyakarta: Ainun Nadjib, Suharjono, Priyo Setyawan Jawa Timur: Masdarul Khoiri, Lukman Hakim, Aan Haryono, Ashadi Iksan, Tritus Julan, Solihan Arif, Yuswantoro Bali: Miftahul Chusna Sulawesi Selatan: Abdullah Nicolha Sulawesi Utara: Cahya Sumirat Manager Litbang: Wiendy Hapsari

dupan narkoba di perbatasan Entikong. Pertama, masih kurangnya sarana dan prasarana di pospos pemeriksaan untuk mendeteksi barang yang diselundupkan.”Fasilitas pendeteksi terhadap jalur-jalur di perbatasan yang masih sedikit menyebabkan peredaran dan penyelundupan narkoba di jalur perbatasan Entikong Indonesia dan Malaysia masih marak terjadi,” ujarnya. Kedua, masih berjalannya penyelundupan narkoba meski jaringan sindikat telah dipenjara. Pelaku masih bisa mengendalikan jaringan meski sudah menjalani tahanan. Ketiga, tidak tegasnya supremasi hukum yang dijalankan. Keempat, selalu bermunculan cara baru yang dilancarkan oleh sindikat. Kelima, dimanfaatkannya jalan pintas (jalur tikus) oleh para sindikat. Elyta menyebut panjang perbatasan darat Kalimantan Barat-Malaysia ialah sepanjang 965 kilometer dan di sepanjang garis tersebut terdapat banyak jalan pintas yang rawan untuk jadi jalur penyelundupan. Satu faktor lain yang menjadi kendala menanggulangi sindikat penyelundupan adalah perbedaan peraturan antara Indonesia dan Malaysia. Hasil penelitian menemukan bahwa perbedaan hukum tersebut berfokus pada perbedaan hukuman yang diberikan ke dua negara pada pelaku penyelundupan. “Namun Indonesia dan Malaysia telah berupaya untuk mencari jalan tengahnya melalui perundingan yang dilakukan antara Direktorat Reserse NarkobaKepolisian Daerah Kalimantan Barat dengan polis di Kuching,” ujar Sekretaris Prodi Fisip Untan ini. Meski perbatasan di Kalbar jadi jalur empuk bagi sindikat penyelundup, namun Elyta mengapresiasi upaya perbaikan yang dilakukan. Pada 2020, kata dia, sudah terlihat upaya dari Direktorat Reserse Narkoba (Ditresnarkoba) Polda Kalbar memperketat penjagaan di perbatasan Perkuat Entikong. “Bahkan anjing pelacak akan ditempatkan di Polsek Entikong. Hal tersebut saya rasa

Redaktur Bahasa: Jaelani Ali Muhammad Head of Socmed: Chamad Hojin Head of Multimedia: Arie Yudhistira Koordinator Fotografer: Astra Bonardo Wakil Koordinator Fotografer: Hasiholan Siahaan Fotografer: Eko Purwanto, Yulianto, Adam Erlangga, Yorri Farli, Ramadhan Adiputra, Ali Masduki Redaktur Pelaksana Artistik: Wisnu Handoko Manajer Artistik: I Mashyudi Wakil Manajer Artistik: Win Cahyono Direktur Content, Regional dan Sirkulasi: Pung Purwanto CFO: Erwin Andersen Deputi CFO: Betty Septarini Sales Division Head: VP Sirkulasi & Distribusi/ Branch Operation Division Head: Dony Irawan Informasia Baris BW Rp.45.000/mmk Kolom FC Rp.60.000/mmk Kolom BW Rp.45,000/mmk

merupakan satu langkah maju, terutama untuk menangani masalah ketersediaan fasilitas alat detektor,” ujarnya. Direktur Tindak Pidana Narkoba Bareskrim Polri Brigjen Pol Krisno H Siregar membeberkan modus operandi penyelundup di wilayah perbatasan, khususnya Entikong. Menurutnya, pelaku menyembunyikan narkoba di barang bawaan para pendatang atau wisatawan yang datang dari Malaysia. Pelaku berupaya mengelabui para petugas di PLBN. Selain itu, modus lainnya bisa menggunakan pengerah jasa tenaga kerja Indonesia (PJTKI) yang menjemput barang tersebut di perbatasan. Berbagai upaya dilakukan untuk menggagalkan tiap upaya penyelundupan di perbatasan,termasuk memperkuat kerja sama dengan semua instansi yang ada di PLBN. “Polri juga mengusulkan moder nisasi peralatan deteksi di PLBN. Sementara pada titik yang ada pengawasan dari otoritas, kami hanya mengandalkan infor masi intelijen,” ujarnya saat dihubungi, Sabtu (20/3) . Memutus Suplai di Darat Maraknya penyelundupan narkoba lewat perbatasan diakui oleh Kepala BNN Provinsi Kalbar Brigjen Pol Budi Wibowo. Bahkan, dalam tiga bulan terakhir jumlah narkoba yang diselundupkan naik. Meningkatnya kasus penyelundupan di perbatasan setidaknya bisa dilihat dalam dua aspek. Pertama, dari sisi berkas perkara. Selama 2020, BNNP Kalbar menangani 17 berkas perkara, sementara pada 2021, sampai Maret ini saja saja sudah ada 11 berkas perkara yang ditangani. Kedua, dari sisi jumlah barang bukti juga terjadi kenaikan signifikan. Selama setahun pada 2020, barang bukti sabu yang disita sebanyak 12 kg lebih, sedangkan tahun ini, sampai Maret sudah disita 19,6 kg sabu. Menurut Budi, kalau berdasarkan data tentu ada peningkatan kasus. Namun, menurutnya, dalam melihat data tersebut seharusnya digunakan perspektif berbeda. Baginya, makin tinggi kasus yang ditangani membuktikan kiner-

ja aparat makin baik. “Kasus narkoba ini kan tidak sama dengan kasus semacam penipuan, orang yang akan melapor kalau ditipu. Kalau narkoba kan oleh penyelidikan yang mencari. Jadi harusnya semakin tinggi kasus datanya maka semakin meningkatlah kinerja aparat. Harusnya seperti itu memandangnya,” ujarnya saat dihubungi Sabtu (20/3). Dengan fakta banyaknya kasus penyelundupan yang digagalkan sejauh ini, menurut Budi itu menunjukkan BNPP Kalbar lebih fokus pada bagaimana startegi supply and demand. “Artinya bagaimana kami mereduksi suplainya. Jaringannya yang kami putuskan, bukan pengguna yang level gram-graman itu,” ujar nya. Dalam lima bulan terakhir, atau jika ditarik ke November 2020, lanjut Budi, hampir semua percobaan penyelundupan lewat darat berhasil digagalkan. Termasuk satu ujicoba penyelundupan lewat udara juga bisa digagalkan. Dijelaskan, saat ini suplai dari bandar sudah terhambat oleh gerakan seluruh stakeholders yang terdiri atas BNNP, Polda, Bea Cukai, Imigrasi dengan Pengamanan Perbatasan. Namun pihaknya tetap mewaspadai langkah sindikat, termasuk perubahan modus operandi. Sebab, kata dia, selama pencandu tidak direhab dengan sembuh total, permintaan pasti akan terus ada. “Saat ini kami sudah bisa menahan mereka (bandar) lewat darat. Nah, mereka (peng guna) pasti akan tetap berupaya mencari cara bagaimana memenuhi kebutuhannya, ini yang kami waspadai,” papar nya. Budi mengatakan, setelah jalur darat digagalkan, tidak menutup kemungkinan pelaku penyelundup akan mencoba lewat perairan. Namun BNNP Kalbar mencoba mendahului. “Kami memberikan pemahaman dan daya tangkal kepada masyarakat perairan, kami minta mereka menyatakan perang terhadap narkoba,” tandasnya. pbakti munir/ faorick pakpahan

Business Event Kavling FC Rp.29.750.000/mmk Posisi Khusus Lidah Rp.200.000/mmk Jaket Rp.200.000/mmk Layanan Langganan: (021) 3911518, Fax : (021) 3929758 Iklan Display: (021) 3915634, Fax : (021) 3927721 Iklan Baris/Kolom, Divisi Sirkulasi dan Distribusi: Gedung SINDO Jalan Wahid Hasyim No. 38, Jakarta 10340 Telepon / Fax. (021) 391 4672, E-mail: [email protected], [email protected] [email protected]; [email protected] Penerbit: PT Media Nusantara Informasi, Percetakan: PT Media Nusantara Press Bank: BCA Cabang Wahid Hasyim A/C 478-301152-5, Anggota SPS Nomor 404/2005/11/2011, Terbit Tujuh Kali Seminggu. Alamat: Gedung SINDO Jalan Wahid Hasyim No. 38, Jakarta 10340 Telepon(Hunting): (021) 3926955, Fax: (021) 392 9758, Redaksi: (021) 392 6955, Fax: (021) 392 7721

Wartawan KORAN SINDO selalu dibekali tanda pengenal dan dilarang meminta / menerima apapun dari nara sumber

5

SENIN 22 MARET 2021

NASIONAL

Alutsista TNI Semakin Canggih Belum lama ini pemerintah mengoperasikan Kapal Perang Republik Indonesia (KRI) Alugoro-405, kapal selam jenis diesel electric untuk memperkuat jajaran Tentara Negara Indonesia Angkatan Laut (TNI AL), khususnya Satuan Kapal Selam (Satsel) Komando Armada (Koarmada) II Surabaya. Yang menarik KRI Alugoro-405 ini dibuat di Indonesia melalui kerja sama PT PAL dengan DSME Korea Selatan. KRI Alugoro-405 merupakan kapal selam ketiga jenis diesel electric setelah dua KRI sebelumnya, yaitu KRI Nagapasa-403 dan KRI Ardadedali-404. Nama Alugoro untuk kapal selam ini diambil dari nama senjata Prabu Baladewa yang berbentuk gada dengan kekuatan pemusnah sangat dahsyat. Pemberian nama Alugoro kepada kapal selam TNI AL dengan harapan dan penuh keyakinan mampu melaksanakan tugas dan fungsinya sebagai senjata yang memiliki daya hancur yang besar dalam setiap peperangan. Menteri Pertahanan (Menhan) Prabowo Subianto menyebut kapal selam yang diberi nama Alugoro-405 sebagai wujud pentingnya pertahanan untuk menjaga Tanah Air. “Bukan karena kita ingin gagah-gagahan, bukan karena kita ingin mengancam siapa pun. Kita tegaskan bahwa bangsa Indonesia cinta damai, tapi lebih cinta kemerdekaan,” kata Prabowo akhir pekan lalu. Dia menyebut Indonesia harus memiliki kekuatan yang cukup untuk menjaga kedaulatan, melindungi segenap tumpah darah, kesatuan, dan keutuhan wilayah dari ancaman tentara negara asing. Melalui perencanaan strategis mengenai modernisasi alutsista, hal itu sesuai dengan amanah Presiden Jokowi yang memerintahkan bahwa seluruh industri pertahanan dalam negeri wajib diikutsertakan dalam proses peremajaan seluruh alat pertahanan negara. Prabowo memaparkan bahwa alat pertahanan banyak yang sudah sangat tua dan sudah saatnya diremajakan. Untuk itu peran dari industri pertahanan akan sangat menonjol. “Kita harap peran serta, inisiatif, kerja keras teknolog-teknolog kita, sarjana-sarjana kita, cendekiawan kita, dari ahli-ahli kita. Kita harap semua bersatu untuk kerja keras,” tegasnya. Kapal Alugoro-405 selanjutnya diserahkan kepada Mabes TNI AL dan Pangkoarmada II selaku pengguna. Kepala Staf Angkatan Laut (Kasal) Laksamana TNI Yudo Margono mengatakan KRI Alugoro-405 merupakan kapal selam kelas DSME 1400 ketiga dari tiga buah kapal selam sejenis, dibangun di Indonesia melalui kerja sama PT PAL dengan DSME Korea Selatan dalam rangka transfer of technology dan transfer of knowledge . Menurut dia, selesainya KRI Alugoro-405 menjadi kontribusi positif bagi kemajuan industri pertahanan dalam negeri. “Ini menjadi indikator keberhasilan dari program pemerintah menuju kemandirian industri pertahanan dengan mengembangkan sumber daya bangsa yang profesional, inovatif, adaptif terhadap segala dinamika lingkungan strategis, produktif dengan kontribusi yang nyata melalui pelaksanaan tugas serta memiliki daya saing yang kompetitif di kawasan,” ungkap KSAL. Bentuk Koarmada RI Menurut Yudo, TNI AL berencana membentuk Komando Armada Republik Indonesia (Koarmada RI) yang membawahkan Koarmada I (Jakarta sampai Aceh), Koarmada II (Jateng sampai Kalimantan), dan Koarmada III (Jatim hingga Indonesia Timur). Dikatakannya, pembangunan kekuatan pertahanan negara di laut harus

mempertimbangkan keselarasan ketiga pilar, yaitu pembangunan sumber daya manusia (SDM), alutsista, dan organisasi. “SDM yang tangguh dan profesional berbanding lurus dengan pembangunan alutsista serta diikuti dengan organisasi yang memadai,” ujarnya. Menurut Yudo, dalam membangun organisasi TNI AL tentunya harus dimulai dari perencanaan matang dengan pendekatan force planning yang realistis berlandaskan pada regulasi yang berlaku serta mempertimbangkan potensi ancaman dan dinamika lingkungan strategis. “Perkembangan lingkungan strategis global dan regional perlu upaya pendekatan baru untuk mewujudkan kekuatan pertahanan khususnya kekuatan laut mengingat negara-negara besar fokus ke arah laut,” katanya. Menurut pengamat militer dan intelijen Susaningtyas Kertopati, sejumlah negara Eropa, Amerika, dan Asia seperti Jepang dan Korea mengagumi kehebatan prajurit Indonesia seperti Komando Pasukan Khusus (Kopassus) yang merupakan pasukan elite TNI AD dan Komando Pasukan Katak (Kopaska) TNI AL. “Kita bangga loh Indonesia banyak sekali kekhasannya, kayak Kopassus berkali-kali menjuarai menembak mengalahkan bule-bule itu dengan senjatanya dari Pindad. Bayangkan. Jadi orang bule bertanya, hebat banget ya Kopassus bisa seperti itu,” tuturnya. Bukan hanya itu, kekaguman mereka terhadap pasukan elite TNI juga ditujukan kepada Kopaska. Mantan anggota Komisi I DPR itu menuturkan bagaimana temannya yang merupakan anggota militer dari sebuah negara mengakui kehebatan prajurit TNI. “Juga Kopaska TNI AL, punya kekuatan napas lebih dari bule-bule itu. Mereka bisa tahan di bawah air itu lama, enggak tahu gimana ? Sampai teman saya militer dari negara lain bilang orang Indonesia sakti. Kalau perang gerilya itu Kopassus itu jagonya, jangan harap bisa menang,” katanya. Perempuan yang akrab dengan sapaan Nuning itu mengakui banyak negara luar yang ingin mengetahui sistem pertahanan Indonesia. “Banyak sekali animo dari Kemhan di Eropa atau Amerika, Korea dan Jepang, ingin tahunya banyak terkait sistem pertahanan kita, sistem keamanan dan juga intelijen kita. Mereka itu sangat tertarik karena banyak yang khas,” ungkapnya. Akuisisi Alutsista Menurut Kepala Staf TNI Angkatan Udara (Kasau) Marsekal TNI Fadjar Prasetyo, pihaknya akan mengakuisisi beberapa alutsista modern secara bertahap. Akuisi tersebut dimulai pada tahun ini hingga 2024. Fadjar menuturkan, hal itu sejalan dengan komitmen yang disampaikan Menhan Prabowo Subianto untuk terus melaksanakan diplomasi pertahanan dengan negara sahabat guna mempercepat proses pembangunan kekuatan TNI. “Kini telah mulai menampakkan titik terang. Mulai tahun ini hingga tahun 2024, kita akan segera merealisasi akuisisi berbagai alutsista modern secara bertahap,” kata Fadjar. Adapun beberapa alutsista yang segera diakuisisi adalah pesawat multi-role combat aircraft, F-15 EX dan Dassault Rafale, radar GCI3, pesawat berkemampuan airborne early warning,pesawattanker,yaknimultirole tanker transport, pesawat angkut C-130 J, dan sebagainya. Dalam waktu dekat, pihaknya juga akan melaksanakan modernisasi berbagai pesawat tempur yang pelaksanaannya akan dimulaipadatahunini. “Esensiterpenting dari penambahan alut-

PERKUAT PERTAHANAN NKRI Pemerintah terus memperkuat pertahanan Indonesia dengan sejumlah alat utama sistem persenjataan (alutsista) modern. Terbaru pemerintah meluncurkan alutsista kapal selam Diesel Electric Submarine U20911400 produksi PT PAL Surabaya yang diberi nama KRI AIugoro-4O5.

INFO GRAFIS: KORAN SINDO/SUSILO, FOTO: SINDO NEWS

JAKARTA – Alat utama sistem persenjataan (alutsista) Indonesia semakin canggih dan modern. Bahkan beberapa alutsista tersebut diakui sangat hebat. Jenisnya mulai dari senjata, pesawat tempur hingga kapal selam.

TIGA KAPAL SELAM INDONESIA KRI Alugoro-405

KRI Nagapasa-403

KRI Ardadedali-404

PEMBUATAN Dibangun di Indonesia melalui kerja sama PT PAL dengan DSME Korea Selatan dalam rangka transfer of technology sekaligus transfer of knowledge

SPESIFIKASI

KRI ALUGORO-405

405

JENIS SENJATA TEMPUR PUR TERBARU LAINNYA Tipe kelas changbogo Panjang 61,3 meter

Pesawat multi-role combat aircraft F-15 EX

Jet tempur Dassault Rafale

DERETAN SENJATA DAN PESAWAT TEMPUR TNI 1. Sukhoi Su-35 Tiba 2019

9. Tank KMW Leopard 2A4 MTB

2. Pesawat CN 235-220

10. Tank KMW Leopard 2RI MTB

3. Helikopter AS565 MBe

11. Tank Pindad Harimau 105 MT

4. Kapal Perusak Kawal Rudal

12. Tank Doosan Tarantula 90

5. Isuzu Elf NPS 4x4 Giant Bow

13. Tank Pindad Badak 90

6. Tatra T815-7

14. Tank Marder

7. KIA KM250

15. Tank Amfibi Arisgator

8. Alvis Scorpion 90 Light Tank

16. Tank BMP-3F 17. AIM 9 Sidewinder dan AIM 120 AMRAAM

sista bukanlah pada penambahan jumlah platformnya. Namun yang jauh lebih esensial adalah pada peningkatan kemampuan secara signifikan yangdapatkitadayagunakandalam menjaga kedaulatan negara di udara,” tuturnya. Dia mengingatkan para prajurit untuk memastikan terjaganya kesiapan operasional matra udara. Kesiapan itu, menurut dia, dapat dilakukan melalui pembinaan kemampuan personel, pemeliharaan dan perawatan alutsista agar terus berada pada level tertinggi. “Kita harus memastikan kesiapan personel dan satuan dalam mengoperasikan dan memelihara berbagai alutsista matra udara serta melaksanakan berbagai tugas TNI AU secara profesional dan dengan penuh rasa tanggung jawab,” ucapnya. Menhan Prabowo memang berkomitmen memodernisasi autsista dan memperkuat TNI guna menjaga kedaulatan NKRI. Komitmen itu dibuktikan dengan peluncuran kapal perang pengangkut tank (AT-8) H-355 untuk TNI AL yang diberi nama KRI Teluk Weda-526 di Batam, awal Maret lalu. Kapal Angkut Tank KRI Teluk Weda-526 memiliki spesifikasi panjang kapal 117 m, kecepatan maksimal 16 knots (full load ), jumlah ABK sebanyak 111 orang, dapat mengangkut pasukan sebanyak 367 orang serta 15 Tank BMP-3F. Peluncuran kapal perang tersebut dilakukan oleh Kepala Pusat Alat Peralatan Pertahanan Badan Sarana Pertahanan Kementerian Pertahanan (Kapus Alpalhan Baranahan Kemhan) Marsma TNI Asfan Jauhari. Pemerintah juga melakukan pembelian AIM

9 Sidewinder dan AIM 120 AMRAAM armada tempur TNI AU yang didominasi oleh F-16 akan dipersenjatai dengan rudal udara ke udara. Belum lama ini Prabowo Subianto juga menyerahkan kendaraan Armour Indonesian Light Strike Vehicle (ILSV) JForce TNI. Staf Khusus Bidang Komunikasi Publik dan Hubungan Antarlembaga Menhan Dahnil Anzar Simanjuntak mengatakan, kendaraan tersebut diserahkan kepada tiga kepala staf angkatan, yakni KSAD Jenderal TNI Andika Perkasa, KSAU Marsekal TNI Fadjar Prasetyo, dan KSAL Laksamana TNI Yudo Margono. Adapun spesifikasi dari ILSV J-Forces adalah mampu melaksanakan misi penyerangan, pengintaian, komunikasi, patroli jarak jauh, dan bantuan kemanusiaan. Rantis ILSV J-Force juga dilapisi dengan plat baja pelindung yang dapat menahan serangan amunisi. ILSV J-Force merupakankendaraantaktiskarya anak bangsa Indonesia yang difabrikasi di Bandung. Kendaraan ini dibuat oleh PT Jala Berikat Nusantara Perkasa dengan dukungan engineering dari PT Dirgantara Indonesia (PT DI). Menurut Danhil, penyerahan kendaraan tersebut merupakan upaya Kemhan dalam mendukung peningkatan produksi alutsista dalam negeri. “Pengembangan industri pertahanan merupakan bagian terpadu dari perencanaan strategis pengelolaan sumber daya nasional untuk kepentingan pertahanan dan keamanan negara,” ungkapnya. psucipto/sindonews

Bobot 1.800 ton Mampu berlayar lebih dari 50 hari

Menampung lebih dari 40 kru kapal ditambah satu tim pasukan elit TNI AL

Kecepatan ± 21 knot di bawah permukaan air

6

SENIN 22 MARET 2021

oPiNi

Tajuk Jangan Lupakan Protokol Kesehatan rogram vaksinasi Covid-19 di Tanah Air terus diperluas. Setelah tenaga kesehatan dan pekerja publik, kini vaksinasi mulai menyasar masyarakat umum dengan kategori kalangan lanjut usia (lansia). Program pemberian vaksin ini pun disambut antusias. Sejumlah tempat yang menyediakan fasilitas vaksinasi pun selalu ramai dipenuhi masyarakat. Beberapa tempat yang sengaja disediakan pemerintah misalnya di Istora Senayan, Kompleks Stadion Utama Gelora Bung Karno, Jakarta, misalnya. Sejak 16 Maret lalu hampir setiap harinya selaku dipenuhi masyarakat yang ingin mendapatkan vaksinasi. Para lansia ini datang bersama anak atau kerabatnya karena pihak panitia memperbolehkan para lansia ini ditemani satu anggota keluarganya saat hendak divaksin. Pekan sebelumnya, di tempat berbeda, yakni di ICE BSD, Tangerang, Banten, pemandangan serupa juga ditemukan. Di lokasi ini antusiasme masyarakat juga terlihat. Antrean kendaraan menjelang Hall 10 ICE BSD sudah mulai terjadi sejak pagi pada 13 dan 14 Maret 2021. Beruntung, kepadatan antrean ini bisa dipecah karena panitia pelaksana dalam hal ini Grab yang bekerja sama dengan Kemenkes serta Dinas Kesehatan Tangsel membagi tiga jalur antrean, yakni sistem walk-in , kemudian drive thru kendaraan roda empat, dan drive thru roda dua. Penyelenggaraan vaksinasi di dua tempat vaksinasi massal ini relatif lancar. Nyaris tidak ada keluhan signifikan dari para lansia yang mendapatkan vaksin. Hanya saja, karena pendaftaran semua calon penerima vaksin ini dilakukan secara online , banyak lansia yang tidak akrab dengan smartphone sehingga mereka harus dibantu oleh anak atau anggota keluarga lain untuk mendaftar. Momen ini pun seakan menjadi pengingat masa kecil bagi mereka yang dulunya diantar orang tuanya untuk diimunisasi atau vaksin, kini giliran mereka yang mengantarkan orang tuanya untuk vaksinasi. Program penyuntikan vaksin bagi lansia ini kini sudah tersebar di hampir semua provinsi. Untuk mendaftar, masyarakat bisa mengakses website Kemenkes lalu pilih daerah/provinsi yang dituju. Adapun vaksinasi mandiri yang dilakukan oleh swasta biasanya akan disediakan link pendaftaran khusus. Tahapannya cukup simpel, hanya mendaftarkan nama, nomor telepon, dan fasilitas kesehatan yang dituju. Hingga Sabtu (20/3/2021) tercatat jumlah masyarakat yang sudah divaksin pertama mencapai 5.124.948 orang. Adapun jumlah yang mendapatkan vaksinasi kedua sudah mencapai 2.221.200 orang. Terkait ketersediaan vaksin, saat ini pemerintah memiliki 7 juta vaksin yang siap didistribusikan di 34 provinsi. Hanya, untuk sementara akan difokuskan di Jawa-Bali karena dua wilayah ini merupakan kontributor terbanyak terinfeksi virus korona termasuk golongan lansianya. Sekadar diketahui, secara keseluruhan target vaksinasi Covid-19 ini bisa mencapai 181,5 juta penduduk Indonesia. Untuk mencapai target tersebut, tentu tidak bisa semuanya mengandalkan pemerintah sehingga memerlukan keterlibatan pihak swasta maupun lembaga atau organisasi kemasyarakatan. Keterlibatan pihak swasta dengan sentra-sentra vaksinasi tersebut diakui Wakil Menteri Kesehatan Dante Saksono Harbuwono sangat membantu mencapai target vaksinasi secara nasional. Dia membandingkan, sebelum ada sentra-sentra vaksin kecepatan vaksinasi hanya 10.000-100.000 per hari. Namun, setelah ada berbagai sentra vaksinasi, kecepatannya meningkat signifikan menjadi 300.000-380.000 per hari. Kita tentu berharap upaya vaksinasi yang telah dilakukan tersebut bisa mengurangi laju penyebaran Covid-19 yang dalam dua bulan terakhir sudah cenderung melandai. Namun, mesti diingat bahwa sebelum herd immunity terbentuk, vaksin bukanlah satusatunya cara meredam pendemi Covid-19. Penerapan protokol kesehatan masih menjadi cara paling sederhana dan paling utama untuk mencegah penularan korona. Demikian pula bagi mereka yang sudah divaksin, jangan merasa sudah kebal karena punya antibodi, lalu bebas bepergian ke mana saja tanpa protokol kesehatan. p

P

Sinar BLU di Masa Pandemi PROF CANDRA FAJRI ANANDA PH.D Staf Khusus Menteri Keuangan Republik Indonesia

encana pandemi Covid-19yang mengguncang perekonomian dunia membuat banyak negara mengalami penurunan pendapatan, termasuk Indonesia. Problematika anjloknya pemasukan pajak dan penerimaan negara di saat terjadi peningkatan belanja negara untuk mengatasi wabah dan ekonomi menjadi tantangan berat yang tengah dihadapi oleh berbagai negara di dunia, tak terkecuali Indonesia. Kementerian Keuangan mencatat bahwa penerimaan pajak sebesar Rp68,5 triliun per Januari 2021. Adapun realisasi tersebut menurun 15,3% dibandingkan dengan periode sama tahun sebelumnya. Masih rendahnya penerimaan pajak pada awal 2021 karena salah satu kebijakan pemberian insentif yang dilanjutkan bagi pelaku usaha yang masih terdampak pandemi. Di sisi lain, pada 2021 belanja negara juga masih terus meningkat untuk menstimulasi ekonomi nasional akibat pandemi. Sebagai instrumen countercyclical , APBN menjadi salah satu instrumen utama

B

yang memiliki dimensi dampak yang sangat luas baik dalam melanjutkan penanganan di bidang kesehatan, melindungi masyarakat yang rentan, dan dalam mendukung proses pemulihan perekonomian nasional pada tahun 2021. Belanja negara pada APBN 2021 diproyeksikan mencapai Rp2.750,0 triliun atau meningkat 4% dari APBN tahun 2020. Belanja tersebut diarahkan untuk mendukung pemulihan ekonomi dan prioritas pembangunan di bidang kesehatan, pendidikan, teknologi informasi dan komunikasi, infrastruktur, ketahanan pangan, pariwisata, dan perlindungan sosial.

BLU Dorong Pemulihan Ekonomi Nasional Besarnya beban belanja negara di masa pandemi tak mengurangi kewajiban pemerintah untuk terus mengoptimalkan pelayanan publik di segala bidang. Oleh sebab itu, pemerintah perlu terus berupaya mencari alternatif untuk dapat meringankan beban pemerintah dalam penyediaan layanan publik. Terkait hal ini, Badan Layanan Umum (BLU) dapat menjadi salah satu alternatif yang dapat membantu pemerintah dalam penyediaan layanan publik. BLU berperan penting di antaranya melalui penanganan bidang kesehatan, dukungan untuk bidang pendidikan, serta bantuan kepada usaha mikro, kecil, dan menengah (UMKM) dan usaha ultramikro. Kemampuan menjalankan aktivitas bisnis yang fleksibel dengan menonjolkan produktivitas, efisiensi, dan efektivitas, serta tetap akuntabel membuat BLU mampu memenuhi kebutuhan masyarakat dengan cepat.

Keadilan Pembiayaan bagi Nelayan Kecil

DANI SETIAWAN Ketua Harian DPP Kesatuan Nelayan Tradisional Indonesia, Pengajar FISIP UIN Jakarta

eskipun perikanan skala kecil di Indonesia memiliki potensi yang besar dan dalam banyak hal lebih berkelanjutan, posisinya dalam struktur perekonomian masih marginal. Perikanan skala kecil pada posisi yang dirugikan ketika bersaing untuk mendapatkan sumber daya perikanan dan akses pasar dengan armada perikanan besar. Jumlah armada kapal perikanan skala kecil yang dominan tidak lantas mendapat prioritas dalam kebijakan. Posisi superior dalam hal populasi sering hanya menjadi momen perayaan. Umbulumbul janji untuk menghadirkan kesejahteraan kerap dikibarkan hingga menambah ornamen dalam setiap perhelatan panggung kekuasaan. Banyak agenda digelar, tetapi eksekusi adalah satu masalah akut yang kerap menjangkiti para pengambil kebijakan. Salah satu persoalan yang dihadapi nelayan

M

kecil adalah kurangnya informasi dan akses pembiayaan. Satu topik yang terus dibicarakan, tetapi belum terlihat kemajuan yang menggembirakan. Hambatan pembiayaan penangkapan ikan merupakan usaha yang padat modal. Kebutuhannya mencakup modal produksi (pembelian kapal, mesin beserta alat tangkap), modal operasional (biaya melaut seperti membeli BBM, perbekalan, dll) serta untuk memenuhi kebutuhan sehari-hari saat nelayan mengalami paceklik. Pada waktu-waktu tertentu nelayan juga harus menyisihkan dana untuk memperbaiki kapal, mesin atau alat tangkap yang rusak. Di sisi lain penghasilan nelayan cenderung fluktuatif, tidak pasti, dan pola kerja mereka cenderung spekulatif serta berisiko tinggi. Ketika hasil tangkapan banyak, penghasilan digunakan untuk memenuhi kebutuhan hidup, membayar cicilan utang berbunga tinggi, dan sebagian kecil untuk tabungan biaya pendidikan, kesehatan, dan lainnya meskipun tidak sedikit nelayan yang cenderung boros dan konsumtif. Ketika hasil tangkapan sedikit atau tidak ada sama sekali, nelayan mengalami kesulitan keuangan dan terpaksa meminjam untuk memenuhi kebutuhan sehari-hari. Dalam struktur sosial-ekonomi masyarakat nelayan semacam ini, kedudukan pengepul, tengkulak, atau pedagang ikan sangat penting dalam dinamika sosial-budaya masyarakat setempat. Hubungan ekonomi

antara nelayan-tengkulak ini sering menjadi sasaran kritik karena cenderung eksploitatif. Namun pilihan nelayan amat terbatas. Pola kredit perbankan konvensional yang menerapkan suku bunga yang tetap dan keteraturan angsuran kurang cocok dengan pola pendapatan nelayan yang cenderung tidak pasti dan tidak tetap. Perbankan sendiri masih ragu menyalurkan kredit dengan melihat tiga potensi risiko sektor kelautan dan perikanan. Pertama, risiko strategis seperti minimnya jumlah usaha perikanan dan terintegrasi dari hulu ke hilir serta mekanisme transaksi di hulu yang sebagian besar masih bersifat tunai. Kedua, risiko operasional, yaitu karakteristik produk usaha kelautan dan perikanan yang bersifat mudah rusak dan siklus usaha bergantung pada faktor alam. Ketiga, risiko kredit dan permasalahan legalitas. Keengganan perbankan melakukan ekspansi pembiayaan kepada nelayan juga semakin menutup peluang mereka untuk melakukan alih teknologi penangkapan yang membutuhkan biaya besar. Padahal semakin baik teknologi yang dapat dimanfaatkan, semakin besar kemungkinan usaha penangkapan ikan berkembang lebih baik. Inovasi Pembiayaan Persoalan ini merupakan tantangan yang harus dijawab bersama. Kita mafhum, pemerintah telah berupaya menggali berbagai strategi untuk menjawab persoalan ini. Salah satu inisiatif baru yang digulirkan

sejak 2015 adalah Program Jaring (Jangkau, Sinergi, dan Guideline), yaitu program inisiatif OJK dengan Kementerian Kelautan dan Perikanan (KKP) dalam pembiayaan sektor kelautan dan perikanan. Dari data yang disajikan OJK, program ini mengalami tren positif meskipun secara nominal belum signifikan jumlahnya. Peluang besar sebenarnya ada pada skema pembiayaan mikro dan kecil non-perbankan yang dianggap lebih mudah diakses nelayan. Salah satunya melalui Badan Layanan Umum Lembaga Pengelola Modal Usaha Kelautan dan Perikanan (BLU-LPMUKP) di bawah Kementerian Kelautan dan Perikanan. Namun skema pembiayaan ini juga masih menyisakan banyak persoalan di lapangan. Nelayan banyak mengeluhkan model analisis kelayakan kredit lembaga ini lebih mirip standard operating procedure (SOP) perbankan konvensional. Keberhasilan pembiayaan bagi nelayan kecil sangat ditentukan oleh kemampuan lembaga keuangan formal seperti perbankan melakukan inovasi strategi pembiayaan yang lebih adaptif. Promosi dan sosialisasi informasi harus menjadi bagian integral dari penguatan infrastruktur institusi perbankan yang menjangkau luas hingga ke kampung-kampung nelayan. Sejalan dengan itu nelayan juga harus memiliki komitmen untuk terus meningkatkan kapasitas usahanya sehingga membantu perbankan memahami karakteristik usaha yang dijalankan. p

Fakta menunjukkan bahwa BLU tetap mampu memberikan layanan terbaiknya meski di tengah pandemi. Sebagai agen pemerintah dalam penyediaan layanan publik yang tidak mengutamakan keuntungan, BLU turutberkontribusidimasapandemi ini. BLU rumpun kesehatan, dalam hal ini rumah sakit (RS) BLU menangani 34 juta pasien selama tahun 2020, dan 75 RS BLU menjadi RS rujukan penanganan pasien Covid-19. Di bidang usaha masyarakat, BLU memberikan dukungan bantuan permodalan kepada 3.406.629 debitur usaha ultramikro. BLU merupakan bagian dari agen pemerintah yang memiliki kontribusi dalam penerimaan negara melalui penerimaan negara bukan pajak (PNBP). Data menunjukkan bahwa selama 10 tahun terakhir kontribusi BLU dalam penerimaan negara terus mengalami peningkatan. Pada tahun 2012 porsi PNBP terhadap keseluruhan anggaran BLU ini adalah 53,7%, sedangkan 46,3% BLU masih bergantung dari APBN. Lalu, pada tahun 2020 porsi PNBP naik dari 53,7% menjadi 79,21% dan ketergantungan terhadap APBN menurun jadi 20,79%. Selain itu, data juga menunjukkan bahwa ketergantungan anggaran BLU terhadap Anggaran Pendapatan dan Belanja Negara (APBN) juga terus mengalami penurunan yang signifikan dalam delapan tahun terakhir. Pada 2020, porsi PNBP naik dari 53,7% menjadi 79,21%. Sementara ketergantungan terhadap APBN menurun menjadi 20,79%. Sebab itu, kini BLU dinilai semakin mandiri dalam menjalankan fungsinya. Selanjutnya, perkembangan BLU juga tercermin dari data

Kementerian Keuangan yang mencatat bahwa terdapat peningkatan jumlah BLU dari 236 badan pada 2019 menjadi 244 badan sepanjang 2020. Tercatat BLU pada 2020 setidaknya terdiri atas 105 bidang kesehatan, 101 bidang pendidikan, 10 pengelolaan dana, 5 pengelolaan kawasan, dan 23 BLU penyediaan barang dan jasa lainnya. Peningkatan jumlah BLU tersebut terjadi tak lain seiring dinamika layanan yang semakin berkembang sehingga alternatif pilihan BLU pun menjadi meningkat. Prestasi perkembangan BLU tak henti diukir bahkan meski di masa pandemi. PNBP BLU justru mengalamikenaikanketikakomponen penerimaan negara lain selama masa pandemi mengalamipenurunan.KementerianKeuangan (Kemenkeu) menyatakan bahwa pada 2020 penerimaan dari BLU mencapai Rp69,68 triliun atau jauh melampaui dari target sebesar Rp50 triliun. Angka penerimaan BLU 2020 ini lebih tinggi dibandingkan realisasi periode sama 2019 sebesar Rp48,9 triliun. Penerimaan BLU di tahun 2020 didominasi oleh bidang kesehatan yang memang saat ini merupakan garda utama dalam menghadapi pandemi. Perkembangan BLU yang setiap tahun terus mengalami perkembangan positif tersebut merupakan hal yang menggembirakan. Bahkan, dalam satu tahun terakhir, BLU dianggap menjadi solusi untuk meningkatkan berbagai layanan pemerintah antara lain pengelolaan, pariwisata, lingkungan hidup, serta pengelolaan dana bencana. Meski demikian, pemerintah hingga kini juga tetap menjaga agar tidak terjadi komersialisasi pada BLU yang menimbulkan dampak negatif dari

sisi akses pelayanan bagi masyarakat terutama bagi masyarakat yang tidak mampu. BLU dan Optimalisasi Pelayanan Masyarakat Pandemi Covid-19 harus menjadi pembelajaran untuk dapat segera melakukan adaptasi. Terlebih, layanan kepada masyarakat tidak boleh terputus dan justru makin diandalkan sehingga kecepatan pelayanan harus ditingkatkan dengan tetap menjaga akuntabilitas. BLU kesehatan seperti rumah sakit perlu terus meningkatkan pelayanan perawatan dan memberikan edukasi untuk mendukung percepatan penyelesaian pandemi. Selanjutnya bagi BLU pendidikan perlu memastikan kegiatan belajar mengajar tetap berjalan dengan baik untuk menjaga kualitas SDM Indonesia agar tetap unggul dan berdaya saing. BLU dapat bersinergi untuk memberikan layanan publik terbaik yang affordable, available, dan sustainable dalam mendukung social safety net dan pembangunan infrastruktur dalam rangka akselerasi pemulihan ekonomi nasional. Sinergi antar-BLU juga perlu diwujudkan dalam bentuk sharing ekonomi yang efisien dalam menyikapi tekanan ekonomi akibat pandemi. Selama satu tahun terakhir, BLU dianggap menjadi solusi untuk meningkatkan berbagai layanan pemerintah antara lain pengelolaan, pariwisata, lingkungan hidup, serta pengelolaan dana bencana.Sebabitu,besarharapan masyarakat agar BLU mampu tetap memberikan pelayanan semaksimal dan sebaik mungkin dengan efisiensi biaya waktu dan proses bisnis, meski tidak mengutamakan profit. Semoga. p

7

SENIN 22 MARET 2021

INTERNASIONAL

REUTERS

Warga menggelar unjuk rasa menentang rasisme dan kebencian terhadap warga keturunan Asia-Amerika di Liberty Plaza, dekat Gedung Kongres Georgia di Atlanta, Georgia, kemarin.

WASHINGTON - Tren rasisme terhadap warga Amerika Serikat (AS) keturunan Asia bukan hal baru, tetapi memuncak saat penembakan di spa Atlanta, yang menewaskan delapan orang termasuk enam perempuan Asia. Pembunuhan bermotif rasis itu semakin menebalkan trauma kebencian, kekerasan, dan retorika ketakutan terhadap warga keturunan Asia di AS. Rasisme terhadap etnik Asia di AS sebenarnya semakin parah selama pandemi korona karena tudingan mantan Presiden Donald Trump yang menyebutkan virus tersebut berasal dari China. Umumnya, para pelaku rasisme tersebut seiring dengan peningkatan serangan yang dilakukan kelompok nasionalisme kulit putih dan ekstremisme domestik. Bukan hanya di tataran masyarakat, warga etnik Asia juga menjadi korban retorika rasisme pemilu presiden dan parlemen lalu yang menjadikan rasisme sebagai kekuatan bagi kelompok tertentu. Lagi-lagi Trump selalu disalahkan ketika terjadi fenomena rasisme yang meningkat. Anggota Dewan Perwakilan Rakyat (DPR) Judy Chu menuding histeria itu dipicu Trump yang berulang kali mengatakan Covid-19 sebagai “kung flu” yang menjadi bencana bagi komunitas Asia di AS. “Sejak awal pandemi, dia (Trump) selalu menyebut virus China. Kini kita melihat kenaikan kejahatan terhadap warga keturunan Asia,” katanya. Hal sama juga diungkapkan Bee Nguyen dari Partai Demokrat. “Banyak ketakutan di komunitas Asia bukan hanya karena kejahatan kebencian, tetapi pesan xenophobia yang diungkapkan mantan Presiden Donald Trump,” kata anggota DPR Bee Nguyen, dari Par tai Demokrat. “Banyak sejarah yang mengungkapkan kekerasan warga AS keturunan Asia di negara ini. Orang tua dan nenek moyang kita pernah mengalami hal tersebut,” katanya

kepada CNN. Shannon Harper, pakar hukum Iowa State University mengungkapkan, Covid-19 mengizinkan rasisme dan xenophobia karena populasi mayoritas melihat seseorang menyalahkan siapa saja yang berbeda dari mereka. “Itu kenapa warga AS keturunan AS mengalami peningkatan kebencian selama pandemi,” paparnya. Pakar epidemiologi AS, Yulin Shwen, mengungkapkan istilah rasisme berkaitan dengan penyakit membentuk stigmatisasi terhadap kelompok tertentu. Peningkatan sentimen anti-Asia memang tidak bisa dikaitkan sebelumnya. “Virus China, virus orang China, virus Wuhan, menunjukkan seharusnya tidak menggunakannya. Kita tidak seharusnya melekatkan suatu lokasi atau etnik terhadap suatu penyakit,” katanya. Penelitian Center for the Study of Hate and Extremism at California State University, San Bernardino, menyebutkan kejahatan kebencian anti-Asia meningkat 150% selama pandemi. Penelitian yang dilakukan UC San Francisco menemukan peningkatan kebencian itu juga terjadi di ranah media sosial. Hal sama juga diakui Menteri Keamanan Dalam Negeri Alejandro Mayorkas yang mengatakan, ancaman kekerasan domestik meningkat. Stop AAPI Hate, organisasi nirlaba yang melacak insiden kebencian dan diskriminasi terhadap orang Amerika keturunan Asia dan Kepulauan Pasifik di AS, menyebutkan selama Maret hingga De-

sember 2020 melaporkan 2.800 kasus kebencian. Sebanyak 69 kasus di antaranya termasuk serangan verbal dan insiden fisik. Tapi, insiden tersebut tidak dilaporkan kepada polisi. “Saya mengetahui sentimen antiAsia memang sudah sejak lama sebelum pandemi, tapi hingga kini, saya tidak merasa kekhawatiran orang tua saya di publik,” kata koresponden NBC News Vicky Nguyen. “Itu menjadi suatu hal yang menyedihkan bagi saya,” paparnya. Seperti diungkapkan Russell Jeung, profesor di Universitas Negeri San Francisco mengatakan, perilaku rasisme itu terhadap warga Asia terjadi sepanjang waktu perang, pandemi dan krisis ekonomi. “Ketakutan dan stereotip selalu bersembunyi di bawah,” katanya. Rasisme itu juga dialami Jeremy Lin, pemain NBA veteran. Lin mengatakan dirinya kerap menjadi korban rasisme saat dia muda. Tindakan rasisme itu berawal dari verbal hingga kekerasan fisik. “Saya kira banyak warga AS keturunan Asia yang kerap melihat sekeliling ketika mereka pergi keluar atau pergi ke toko,” ujar Lin. Vivien Tsou, direktur lapangan untuk National Asian Pacific American Women’s Forum, menggambarkan perasaan horor akibat pembunuhan di Atlanta masih dirasakan di komunitasnya. Dia mengatakan, masyarakat Asia mendapatkan perlakuan yang sama seperti dialami warga kulit hitam. “Sedangkan fokus saat ini adalah kebencian anti-Asia, itu dilakukan oleh supremasi kulit putih dan siapa pun yang menginginkannya,” kata Tsou. “Itu menjadi kita harus menghadapinya bersama-sama dan meningkatkan solidaritas,” ujarnya. Itu juga diakui Wali Kota Atlanta Keisha Lance Bottoms, seorang Demokrat. Dia mengatakan, warga AS Asia membutuhkan bantuan seperti yang diberikan kepada warga kulit hitam. “Sangat penting untuk mendukung

saudara warga AS keturunan Asia yang telah menjadi target ketidakadilan di Atlanta,” katanya. Peningkatan serangan terhadap warga AS keturunan Asia meningkat sejak tahun lalu ketika banyak masyarakat manula yang tidak mau keluar rumah. Itu karena tudingan bahwa mereka kerap dituduh menyebarkan virus korona. “Komunitas AS keturunan Asia di sini sangat terkejut,” kata Christopher Chan, penasihat Asian American Action FundGeorgiaChapter.Diamengatakan, mereka ingin terjadi penurunan kasus kebencian terhadap warga Asia. Warga Asia keturunan AS menjadi korban rasisme di AS memang bukan pertama kalinya. Warga Muslim, terutama keturunan Asia Selatan, kerap menjadi korban rasisme karena kebencian terhadap pelaku serangan 11 September 2001. Dulu pada Perang Dunia II, ketika ribuan warga migran Jepang membangun kehidupan di AS juga mengalami rasisme. Sementara itu, ratusan orang berdemonstrasi di Georgia State Capitol di Atlanta pada Sabtu waktu setempat untuk mendukung komunitas Asia-Amerika. Itu sebagai bentuk kepedulian terhadap penembakan di spa yang mengakibatkan delapan orang, termasuk enam orang Asia. Mereka membawa poster bertuliskan, “kita bukan bagian dari virus” dan “hentikan kebencian terhadap Asia”. “Saya ingin meyakinkan dunia dan orang mengetahui bahwa saya ada di sini dan saya terlihat,” kata peserta demonstrasi, Sunghee Han dari Georgia. Timothy Han, penduduk Port St Lucie, Florida, mengatakan perempuan yang dibunuh merupakan bagian dari keluarganya. Senator dari Partai Demokrat Raphael Warnock dan Jon Ossoff memimpin para demonstran berdoa untuk para korban. “Marilah membangun negara dan bangsa ini tanpa ada orang yang mengalami ketakutan karena mereka

adalah bagian dari keluarga,” kata Ossoff. Otoritas Georgia belum menentukan motif utama pelaku penembakan wanita 21 tahun di spa di sekitar Atlanta. Pejabat kepolisian Georgia Robert Aaron Long mengatakan, kecanduan seks menjadikan pelaku melakukan kekerasan. Tapi, anggota parlemen menyatakan bisa anti-Asia menjadi motif pembunuhan tersebut. “Saya tidak tertarik apakah dia mengalami hari yang buruk,” kata Warnock. Sementara itu, Presiden AS Joe Biden meminta warganya untuk secara lantang menentang kebencian rasial. Dia pun memperingatkan bahwa “sikap berdiam diri” hanya justru mendukung tindakan rasis. Itu disampaikan Biden saat bertemu dengan para tokoh masyarakat keturunan Asia, terkait tragedi penembakan brutal di tiga tempat di Kota Atlanta dan sekitarnya pada Selasa (16/3). “Tren itu juga muncul di tengah pandemi Covid-19, dan rasisme sudah menjadi racun yang telah lama menghantui dan mengganggu bangsa kita, dan itu yang harus dibasmi oleh warga AS,” kata Biden. Dia pun mendesak Kongres untuk mengesahkan undang-undang anti-kejahatan rasial terkait virus korona yang digulirkan awal bulan ini oleh dua anggota parlemen keturunan Asia. Bila disahkan, Rancangan UndangUndang (RUU) itu akan menjadi payung hukum bagi Departemen Kehakiman untuk memerangi kriminalitas tersebut. RUU ini akan mempercepat respons dari pemerintah federal terhadap meningkatnya kejahatan rasial yang kian parah selama pandemi. Namun, Biden menyatakan bahwa kita semua harus bergerak demi mendukung penegakan hukum. “Kebencian tidak punya tempat di Amerika. Ini harus dihentikan. Itu bergantung pada diri kita semua untuk bersama-sama menghentikannya,” paparnya. p andika h mustaqim

Negara Maju Tak Izinkan Negara Berkembang Kembangkan Vaksin LONDON - Negara-negara kaya termasuk Inggris menolak proposal untuk membantu negara berkembang mengembangkan kemampuan memproduksi vaksin sendiri. Padahal, negara-negara miskin telah meminta Badan Kesehatan Dunia (WHO) membantu mereka. Namun, negara-negara kaya berdalih pada hukum internasional tidak mengizinkan mereka mendukung pengembangan vaksin di negara berkembang. Itu terungkap dalam salinan teks negosiasi resolusi WHO mengenai isu tersebut. Selain Inggris, Amerika Serikat (AS) dan Uni Eropa juga ikut bergabung dalam penolakan tersebut. “Kita bisa saja bersepakat untuk mempermudah negaranegara memproduksi lebih banyak vaksin dan obat di dalam negeri, termasuk inisiatif yang akan membiayai dan memfasilitasinya,” kata Diarmaid McDonald dari Just Treatment, kelompok yang mendukung akses

yang berkeadilan untuk obatobatan, dilansir BBC . “Inggris dalam posisi yang menentang hal itu dengan berupaya menyingkirkan ide-ide progresif di dalam teks tersebut,” kata McDonald. Melansir BBC , seorang juru bicara pemerintah Inggris mengatakan bahwa pandemi global membutuhkan solusi global pula dan Inggris tengah memimpin upaya itu, untuk memastikan akses yang adil di seluruh dunia dalam mendapatkan vaksin dan perawatan Covid-19. Dia menegaskan bahwa Inggris adalah salah satu donatur terbesar dalam upaya internasional untuk memastikan bahwa lebih dari satu miliar dosis vaksin virus korona dikirim ke negara-negara berkembang tahun ini. Banyak pakar menyatakan bahwa akses vaksin yang berkeadilan merupakan faktor kunci dalam mencegah penambahan kasus baru dan kematian, serta bahwa terwujudnya kekebalan

populasi. “Namun, kapasitas memproduksi vaksin di tingkat global baru mencapai sepertiga dari yang dibutuhkan,” ungkap Ellen t’Hoen, pakar kebijakan obat-obatan dan hukum kekayaan intelektual. T’Hoen menjelaskan, hal itu adalah vaksin-vaksin yang diproduksi di negara-negara maju dan pada umumnya disimpan oleh negara-negara maju pula. “Negara-negara berkembang sudah menyatakan butuh pembagian peran, bukan hanya dapat jatah vaksin, namun juga hak untuk memproduksi vaksin,” paparnya. Yang menjadi perhatian adalah untuk membuat vaksin, tidak hanya diwajibkan punya hak untuk memproduksi substansi aktual dari bahan pokoknya yang dilindungi oleh hak paten, namun juga harus punya pengetahuan mengenai pembuatannya karena teknologinya rumit. WHO tidak memiliki kewenangan untuk mengabaikan hak paten, namun organisa-

si itu tengah berupaya membuat negara-negara untuk bisa bersama-sama mencari cara untuk mendongkrak pasokan vaksin. Pembicaraan yang tengah berlangsung di WHO tersebut menggunakan ketentuan-ketentuan dalam hukum internasional untuk menyiasati hak paten dan membantu negara-negara untuk memiliki kemampuan teknis membuat vaksin. Namun, kalangan industri obat menyatakan bahwa mengabaikan hak paten akan menghambat kemampuan mereka untuk berinvestasi lebih lanjut terkait Covid-19 dan penyakitpenyakit lain. Awal bulan ini, perwakilan industri obat-obatan AS menulis surat kepada Presiden Joe Biden dan menyatakan keprihatinan mereka. “Menghapuskan proteksi [atas hak paten] itu akan menghambat respons global atas pandemi,” ungkap mereka. Ini termasuk upaya dalam mengatasi varian-varian baru Covid-19.

REUTERS/JUng YEon-JE/Pool

Seorang pekerja medis menerima dosis kedua vaksin Covid-19 Pfizer-BioNTech di Seoul, Korea Selatan, kemarin.

Kemudian, Anne Moore, pakar imunologi vaksin, khawatir mengenai dampak mengabaikan hak paten bagi penelitian

pada masa depan. “Seiring berjalannya waktu, kita melihat makin sedikit organisasi dan perusahaan komersial yang

bergerak di bidang vaksin karena keuntungannya sangat kecil,” ujarnya. p muh shamil

8

SENIN 22 MARET 2021

EKoNoMI BISNIS

JADWAL IDX CHANNEL lMARKET OPENING 08.30–09.30 Rendy Wijaya - Equity Analyst PT Panin Sekuritas lMARKET REVIEW 10.00–11.00 Tema : Pekerja Soal Wacana THR 2021 Dicicil Said Iqbal - Presiden KSPI (Konfederasi Serikat Pekerja Indonesia) 10.30–11.00 Tema : Prospek Industri Sekuritas di 2021 Kreshna Armand - Analyst FI Rating PT Pefindo l2ND SESSION CLOSING MARKET 15.00-16.00 Muhammad Al Fatih - VP Samuel Sekuritas Indonesia

IHSG: 6.356,16

8,33

KURS RP: USD 14.407

3

EUR 17.177

36

GBP 20.098

13

JPY 13.260

47

HKD 1.855

1

SGD 10.735

3

AUD 11.192

59

Holding Ultra Mikro Bisa Pangkas Bunga Pinjaman UMKM JAKARTA – Pembentukan holding BUMN ultra mikro diharapkan mampu menurunkan suku bunga pinjaman sehingga bisa meringankan beban para pelaku usaha menengah, kecil, dan mikro (UMKM). Menteri Badan Usaha Milik Negara (BUMN) Erick Thohir mengatakan, manfaat positif dari sinergi BUMN untuk ultra mikro akan dirasakan pelaku usaha karena mereka berpeluang besar mendapat pembiayaan berbunga rendah di masa depan. “Ekosistem ini ingin memastikan terdapatnya penurunan bunga pinjaman. Hal tersebut yang selama ini menjadi konteks hambatan kenapa pelaku usaha ultra mikro dan UMKM tidak mendapat pendanaan yang lebih baik,” kata Erick dalam rapat kerja bersama Komisi VI DPR RI di Jakarta akhir pekan lalu. Menurutnya, penurunan suku bunga pinjaman bagi UMKM bisa terjadi karena sinergi antara tiga perusahaan pelat merah, yakni PT Bank Rakyat Indonesia (BRI) Tbk, PT Permodalan Nasional Madani (PNM), dan PT Pegadaian yang akan menurunkan beban dana (cost of fund ) dari ketiganya. “Model bisnis ekosistem ul-

tra mikro akan fokus pada pemberdayaan bisnis melalui PNM, dan pengembangan bisnis melalui Pegadaian dan BRI untuk membuat usaha mikro naik kelas sehingga bisa memasuki tahapan yang lebih tinggi,” ujar Erick. Wakil Menteri BUMN Kartika Wirjoatmodjo mengungkapkan, pegawai PNM dan Pegadaian berpeluang mendapat untung karena perusahaannya berpotensi besar mencetak laba lebih tinggi pasca-holding dibentuk. “Kami meyakinkan sekali lagi tidak ada pengaruh ke kepegawaian. Tidak ada pengurangan pegawai, tidak ada pengurangan benefit, semua berjalan apa adanya. Bahkan, kami meyakini dengan efisiensi kita bisa mem-pass on ini untuk kenaikan benefit bagi (pegawai) PNM dan Pegadaian,” ujar pria yang akrab disapa Tiko tersebut. Di sisi lain, Komisi VI DPR RI secara resmi mendukung pemerintah dalam pembentukan holding BUMN ultra mikro dan

memastikan agar sinergi ini dapat meningkatkan jangkauan layanan kepada seluruh pelaku sektor ultra mikro. Rapat yang dihadiri oleh 40 anggota dewan tersebut dipimpin secara langsung oleh Wakil Ketua Komisi VI DPR Aria Bima. Dalam kesimpulan rapat tersebut, Komisi VI menyatakan dukungan terhadap pembentukan holding dan memahami rencana right issue PT Bank Rakyat Indonesia (Persero) Tbk. Penerbitan saham rencananya dilakukan BRI sebagai salah satu prosedur pembentukan holding yang melibatkan PT Permodalan Nasional Madani (Persero) dan PT Pegadaian (Persero). Wakil Ketua Komisi VI DPR Arya Bima mengatakan, lembaganya akan bersama-sama pemerintah memastikan penguatan kontrol negara terhadap anak usaha BUMN. Penguatan dilakukan melalui keberadaan saham dwiwarna yang akan dipegang pemerintah pada holding BUMN untuk ultra mikro nanti. “Komisi VI DPR mendukung pembentukan holding ultra mikro dan memahami rights issue BRI dengan cara mengalihkan seluruh saham seri B negara pada PMN dan Pegadaian kepada BRI, sepanjang pemerintah masih mempunyai kontrol penuh untuk PMN dan Pegadaian

melalui saham dwiwarna,” tulis Arya seperti dikutip dalam risalah rapat kerja DPR RI. Selain merestui pembentukan holding BUMN untuk ultra mikro, Komisi VI DPR juga meminta Kementerian BUMN memastikan agar sinergi ini dapat meningkatkan jangkauan layanan kepada seluruh pelaku sektor ultra mikro di seluruh wilayah. Komisi yang membidangi urusan industri, perdagangan, koperasi dan UKM, BUMN, dan investasi ini juga meminta Kementerian BUMN membuat target kinerja spesifik dan ter-

ukur atas pembentukan holding BUMN ultra mikro sehingga efektivitas sinergi dapat terwujud. “Komisi VI DPR meminta Kementerian BUMN untuk melakukan pengawasan ketat terhadap holding BUMN ultra mikro sehingga pembentukan holding benar-benar efektif dan memberikan manfaat bagi pertumbuhan ekonomi nasional, khususnya di sektor ultra mikro,“ ucapnya. Sementara itu, Anggota Komisi VI DPR Nasim Khan menambahkan, pembentukan holding ultra mikro bisa memu-

dahkan masyarakat dan pelaku UMKM dalam mengakses produk keuangan berbiaya murah hingga pelosok negeri. Dengan menyatukan tiga perusahaan keuangan; BRI, PNM, dan Pegadaian, seharusnya dapat menjadi lebih efisien dalam melayani nasabah. “Apalagi (holding ultra mikro) ini didukung dirut BRI, Pegadaian, dan PMN, yang kita tahu mereka sangat terbukti kredibel prestasinya. Insya Allah holding ultra mikro bisa lebih menyentuh dan membantu masyarakat dalam mengakses permodalan,” tambah Na-

sim yang juga ketua Kelompok Fraksi (Kapoksi) Partai Kebangkitan Bangsa (PKB). Kendati mendukung langkah percepatan pembentukan holding ultra mikro, Nasim tetap meminta pemerintah untuk menerapkan prinsip kehatihatian dan strategi bisnis yang jelas agar perusahaan tersebut nantinya bisa berkembang. “BRI dan PNM adalah perusahaan BUMN yang sudah berhasil mencetak laba kendati dalam situasi genting seperti saat ini (Covid-19). Laba bersih PNM misalnya, bisa mencapai Rp358 miliar dan laba BRI bisa mencapai Rp18,65 triliun. Prestasi ini yang harus dikembangkan,” harapnya. Nasim menjelaskan, dua perusahaan tersebut juga sudah menjalankan bisnisnya hingga ke pelosok-pelosok negeri. Jika tujuan holding adalah meningkatkan UMKM terutama agar bisa naik kelas, maka harus didukung tapi dengan prinsip kehati-hatian. “Jangan sampai keinginan memajukan UMKM justru malah membuat PNM dan BRI terseok-seok karena terhambat berbagai prosedur yang ditetapkan akibat holding . Kami menekankan adanya proses holding yang dipermudah,” pungkasnya. p taufik fajar

MBR Dapat Keringanan BLU untuk Miliki Hunian JAKARTA – Sebagai agen pemerintah, Badan Layanan Umum (BLU) pada 2021 diharapkan mampu meningkatkan dan mempertajam perannya dalam percepatan layanan masyarakat serta dapat mendorong pertumbuhan ekonomi. Menteri Keuangan (Menkeu) Sri Mulyani mengatakan, pengelola BLU ini bisa disalurkan melalui pemberian bantuan (Bantuan Langsung Tunai/ BLT) dalam mendapatkan rumah bagi masyarakat berpendapatan rendah (MBR) oleh Kementerian Pekerjaan Umum dan Perumahan Rakyat (PUPR). “Kementerian PUPR juga memberikan bantuan untuk Rp759.000 kepada masyarakat berpendapatan rendah

PLN Dukung Vaksinasi Nasional General Manager PLN Unit Induk Distribusi Jakarta Raya (Disjaya) Doddy B Pangaribuan (kanan) menyaksikan petugas memeriksa Power Bank PLN di Tennis Indoor Senayan GBK, Jakarta, akhir pekan lalu. PLN Disjaya melakukan energize sambungan listrik sementara 1juta Volt Ampere (VA) untuk Sentra Vaksinasi Bersama untuk mendukung tempat penyimpanan vaksin yang membutuhkan energi listrik yang cukup dan andal.

untuk memiliki rumah,” kata Sri Mulyani dalam video virtual di Jakarta akhir pekan lalu. Dia pun melanjutkan, ada kawasan dan jasa lain di dalam membantu usaha mikro, kecil, dan menengah (UMKM) yang terpukul sangat berat akibat pandemi virus korona (Covid19) dengan melalui skema BLU. Dalam kesempatan yang sama,DirekturJenderalPerbendaharaan Kementerian Keuangan Hadiyanto mengaku beberapa hal yang harus dilaksanakan dan menjadi perhatian bersama untuk pengelolaan BLU, yakni memastikan agar program dan kegiatan tahun 2021 selaras dengan rencana kerja pemerintah tahun 2021. Terutama pada

prioritas nasional. Secara terpisah, Direktur Utama Pusat Pengelolaan Dana Pembiayaan Perumahan (PPDPP) Arief Sabaruddin menjelaskan, dari 38 bank pelaksana yang bekerja sama dengan PPDPP, sebanyak 24 bank pelaksana telah menyalurkan dana Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) per Senin (15/3). Dari jumlah tersebut tercatat sebanyak 7.266 unit rumah senilai Rp794,250 miliar atau 4,61% dari total unit yang ditargetkan pemerintah tahun 2021. Sehingga, total penyaluran dana FLPP dari tahun 2020 hingga 2021 mencapai Rp56,39 triliun untuk 772.121 unit rumah. prina anggraeni

KORAN SINDO/YORRI FARLI

Angela Simatupang Terpilih sebagai Presiden IIA Indonesia JAKARTA – The Institute Internal Auditors Indonesia (IIA Indonesia) mengumumkan Angela Simatupang terpilih sebagai president of IIA Indonesia periode 2021-2024. Sebelumnya Angela adalah vice president IIA periode 2018-2021 yang juga masih menjabat sebagai direktur Global Board RSM International. Dalam pemaparan kepada anggota IIA Indonesia, Angela menyampaikan perlunya pergeseran fokus IIA Indonesia dari organization focused menjadi memberfocused, tetapi tetap sejalan dengan visi dan misi IIA Global. Juga disampaikan bahwa IIA Indonesia harus memiliki tujuan, yaitu untuk membuat anggotanya berdaya menjadi auditor internal yang profesional, tepercaya, dan berharga bagi pemangku kepentingan mereka. Hal ini menjadi semakin penting karena Indonesia meru-

Indikator Bursa Efek Indonesia DATA 19 MARET 2021

326,60

1,93

pakan negara terbesar di Asia Tenggara dan menempati posisi populasi terbesar keempat di dunia yang berpotensi menjadikan Indonesia sebagai 10 besar ekonomi dunia. Untuk itu Angela berharap IIA Indonesia dapat menjadi sumber utama bagi anggota dan profesi auditor internal, memungkinkan auditor internal professional diakui sebagai profesi yang penting untuk meningkatkan dan melindungi nilai organisasi. “Penting agar auditor internal diakui sebagai fungsi yang tidak tergantikan dan sangat diperlukan untuk memungkinkan adanya tata kelola, manajemen risiko, dan pengendalian yang efektif,” ujar Angela setelah acara pemilihan secara daring di Jakarta belum lama ini. Menurut Angela, IIA memiliki peranan strategis dan kritis bagi organisasi yang ingin memiliki tata kelola yang baik dan Kode ACES ADRO AKRA ANTM ASII BBCA BBNI BBRI BMRI BNGA BSDE BTPS

18-Mar 1530 1270 3370 2290 5725 33525 6275 4760 6800 1100 1245 3630

Ttg 1580 1300 3410 2280 5775 33850 6275 4750 6800 1130 1255 3630

Trd 1505 1240 3340 2210 5625 33125 6150 4670 6700 1090 1225 3550

19-Mar 1570 1300 3380 2250 5775 33800 6150 4670 6775 1105 1225 3560

IST

ANGELA SIMATUPANG

saat ini profesi auditor internal terus berkembang dengan tingkat kinerja dan pengakuan yang tidak konsisten. Untuk itu Angela menetapkan tiga tujuan utama yang ingin dicapai: pertama membuat profesi ini menjadi kuat, kedua membuat personelnya kompeten, dan yang ketiga memastikan organisasi profesi ini memiliki keberlanjutan. IIA Indonesia merupakan Poin 40 30 10 -40 50 275 -125 -90 -25 5 -20 -70

% 2.61% 2.36% 0.30% -1.75% 0.87% 0.82% -1.99% -1.89% -0.37% 0.45% -1.61% -1.93%

Volume 58,570,800 377,618,800 12,638,600 123,414,200 80,429,800 25,170,600 29,812,800 151,268,300 75,357,000 12,247,500 8,925,800 5,327,100

PER 33.05 19.17 16.44 47.88 14.33 30.46 35.16 31.28 18.53 13.63 26.29 32.71

Program Belanja Berhadiah

organisasi profesi yang memayungi profesi auditor internal di seluruh Indonesia. IIA Indonesia didedikasikan untuk kemajuan dan pengembangan profesi auditor internal dan merupakan rumah dari profesi auditor internal di Indonesia. Secara global IIA memiliki lebih dari 200.000 anggota pada lebih dari 165 negara. Di Indonesia, tercatat lebih dari 2.600 profesional yang menjadi anggota IIA. Seluruh governor yang mengawasi pengelolaan institusi ini merupakan relawan yang ditunjuk oleh para anggotanya. Beberapa aktivitas yang dilakukan IIA Indonesia antara lain mengadvokasi dan mempromosikan nilai yang ditambahkan oleh auditor internal ke dalam organisasi mereka serta memberikan kesempatan pendidikan dan pengembangan profesional yang komprehensif . pheru febrianto Kode CPIN CTRA DMAS EXCL GGRM HMSP ICBP INDF INTP JPFA KLBF MAPI

18-Mar 6750 1195 250 2210 36600 1440 8700 6300 12925 1830 1575 800

Ttg 7000 1200 250 2230 38200 1535 8875 6500 13850 2020 1625 815

Trd 6700 1180 244 2190 36525 1420 8625 6275 12925 1850 1565 790

19-Mar 6950 1180 248 2210 37775 1535 8825 6500 13800 1920 1605 800

KORAN SINDO/ASTRA BONARDO

CMO PT Lippo Malls Indonesia Danny Crayton (berdiri kanan) bersama Head of Digital Lippo Malls Indonesia Gebreine Jessyca Palit (berdiri kiri) menyaksikan pelayanan customer menggunakan aplikasi loyalty rewards Lippo Malls versi 3.0 terbaru Styles di Lippo Mall Puri Kembangan, Jakarta Barat, akhir pekan lalu. Bertepatan dengan perayaan Anniversary Ke-32 Tahun Lippo Malls, Styles menghadirkan program belanja dengan total hadiah senilai lebih dari Rp7 miliar.

Poin 200 -15 -2 0 1175 95 125 200 875 90 30 0

% 2.96% -1.26% -0.80% 0.00% 3.21% 6.60% 1.44% 3.17% 6.77% 4.92% 1.90% 0.00%

Volume 21,133,700 9,604,000 55,097,000 18,277,000 4,188,200 275,041,700 15,236,900 18,918,100 10,476,800 100,115,700 99,340,800 14,267,400

PER 33.07 22.40 13.72 64.73 7.58 15.98 19.83 10.78 26.79 23.40 28.19 N/A

Kode MDKA MEDC MNCN PGAS PTBA PWON SMRA TLKM TOWR ULTJ UNTR UNVR

18-Mar 2440 625 1050 1405 2750 580 1030 3450 1145 1530 21700 6600

Ttg 2430 620 1060 1425 2780 585 1030 3440 1150 1535 21875 6750

Trd 2370 605 1030 1375 2720 565 995 3380 1110 1520 21425 6525

19-Mar 2410 615 1040 1425 2760 565 1010 3440 1150 1535 21875 6750

Poin -30 -10 -10 20 10 -15 -20 -10 5 5 175 150

% -1.23% -1.60% -0.95% 1.42% 0.36% -2.59% -1.94% -0.29% 0.44% 0.33% 0.81% 2.27%

Volume 55,474,800 73,980,600 21,877,400 101,387,300 50,493,100 21,979,300 19,930,300 140,000,000 86,962,700 476,400 8,501,000 24,004,400

PER 59.58 N/A 6.73 N/A 12.87 23.87 78.97 18.10 21.76 14.79 13.48 35.12

9

SENIN 22 MARET 2021

EKOnOmI bisnis

SaatnyaIndustriFilmPulihKembali JAKARTA - Pandemi Covid-19 telah memporak-porandakan berbagai dunia usaha termasuk industri film. Saat ini para pelaku industri film membutuhkan bantuan dari pemerintah untuk mengucurkan stimulus agar bisa pulih kembali dan menghibur masyarakat Indonesia. Menurut catatan insan perfilman jumlah pekerja industri film, animasi, dan video Indonesia sekitar 50.000 orang di tahun 2019. Pekerja bioskop, rata-rata 10 orang per layar sebelum pandemi dengan jumlah layar 2.217. Namun jumlah tersebut menurun drastis saat pandemi melanda. Sejak Covid-19 merebak film yang dirilis di bioskop turun dari 129 ke 7 judul saja, dan bioskop dari 420 hanya beroperasi 190 selama pandemi. Dengan kondisi tersebut, otomatis banyak pekerja film yang kehilangan pekerjaan. Melihat fenomena tersebut, Menko Perekonomian Airlangga Hartarto mengaku, pemerintah saat ini tengah menyiapkan solusi dan stimulus untuk menggerakkan kembali industri film. Saat bertemu dengan insan perfilman pada akhir pekan lalu, Airlangga mendengarkan keluh kesah mereka. Dalam kesempatan tersebut tampak hadir, Mira Lesmana, Joko Anwar, Angga Dwimas Sasongko, Dian Sastrowardoyo dan anggota Komisi I DPR yang juga bintang besar layar lebar Nurul Arifin serta sejumlah insan film yang lain. Airlangga menyatakan memahami keluhan insan film yang sangat terdampak pan-

demi Covid-19, “Saya sendiri sudah ke bioskop, tapi hanya saya sendiri yang nonton tidak ada yang lain, padahal itu weekend,” ujar Airlangga. Menurut dia, masyarakat sudah cukup banyak yang datang ke mal dan makan di restoran walaupun tidak penuh, tapi masih takut masuk bioskop. Karena itu perlu ada kampanye juga agar masyarakat punya keberanian ke bioskop, dan merasa aman. Lakukan berbagai prosedur dan sertifikasi kesehatan, kemudian tunjukkan pada masyarakat. Untuk stimulus, Airlangga berjanji akan mencari formulasi yang tepat, agar yang terbantu betul-betul pekerja film, bukan hanya bioskop yang didominasi 4 jaringan bioskop besar. Untuk mencari formulasi yang tepat dan dapat dipertanggungjawabkan maka KPC PEN akan melakukan diskusi intensif dengan kelompok kerja dari industri film. “Presiden secara langsung telah memberi arahan kepada saya, khususuntukindustriperfilman, pekerja film dan pekerja budaya. Makadariitukehadiraninisangat penting. Saya juga sudah menerima usulan-usulan yang telah disampaikan teman-teman kepada Presiden,” kata Airlangga.

Dia mengakui saat ini bioskop sudah dapat dibuka dengan tetap menerapkan protokol kesehatan, tetapi antusiasme masyarakat untuk kembali menonton di bioskop memang belum pulih seperti dulu. “Pemerintah pasti mendukung penuh upaya kampanye nonton di bioskop yang aman, dengan tetap memperhatikan protokol kesehatan. Saya berharap bioskop-bioskop bisa lebih gencar lagi menggaungkan bahwa nonton di bioskop akan tetap aman dengan memperhatikan protokol kesehatan. Kalau stigma itu bisa sampai ke publik, mereka akan kembali berani nonton di bioskop. Penuhi persyaratan itu, nanti akan kita dorong,” katanya. Dalam pernyataan bersama insan perfilman yang dikirimkan Mira Lesmana dipaparkan, 90% pemasukan industri perfilman berasal dari bioskop yang merupakanhilirdariindustriini. Pemutaran film melalui digital platform atau streaming belum bisa memenuhi kebutuhan produksi film. “Ramainya bioskop memiliki efek sampai ke pekerja film sehingga kampanye meonton film di bioskop perlu digaungkan,” jelas Mira. Untuk itu, insan perfilman menyampaikan usulan stimulus pengalokasian dana pemulihan ekonomi nasional demi mendukung industri perfilman Indonesia.Disampaikaninsanfilmpada tahun 2016, terdapat 2.418 jumlah usaha yang bergerak di subsektor film, animasi dan video, denganjumlahtenagakerjapada tahun 2019 diproyeksikan lebih dari 50.000 orang. Menurut catatan mereka, sejak industri film diangkat dari

ist

Menko Perekonomian Airlangga Hartarto (dua kiri) didampingi Menteri Perindustrian Agus Gumiwang (kiri) saat menerima insan industri perfilman di Jakarta, akhir pekan lalu. Dalam pertemuan tersebut, insan perfilman mengajukan stimulus kepada pemerintah untuk memulihkan kembali industri film yang saat ini sedang terpuruk.

Daftar Negatif Investasi (DNI) di tahun 2016, industri film Indonesia mengalami peningkatan 20% dari segi investasi. Pada akhirnya industri film tanah air mampu tumbuh dan masuk dalam 10 industri film terbesar di dunia. Hal ini merupakan pencapaian tertinggi sepanjang sejarah industri perfilman Indonesia. “Kami mengharapkan pencapaian ini tidak hanya menjadi kenangan,” lanjutnya. Adapun salah satu bentuk stimulus yang diusulkan insan

ESSA Rintis Energi Rendah Karbon melalui Amonia Biru

ist

(Kiri ke kanan) Executive Vice President, Oil & Gas Upstream Technology, Japan Oil, Gas and Metals National Corporation (JOGMEC) Toshikazu Ebato, Director PT Surya Esa Perkasa Tbk (ESSA) Kanishk Laroya (layar), President Director & Chief Executive Officer PT Panca Amara Utama (PAU) Vinod Laroya (layar) dan Chief Operating Officer, Petroleum Division, Mitsubishi Corporation (MC) Hiroki Haba menghadiri acara kerja sama pemanfaatan dan penyimpanan karbon untuk produksi dan pengembangan Amonia Biru secara virtual di Jakarta, akhir pekan lalu.

BLK Harus Bisa Kolaborasi dengan Dunia Usaha JAKARTA - Balai latihan kerja (BLK) dinilai perlu berkolaborasi dengan dunia industri agar pelatihan yang diselenggarakan mampu mengikuti perubahan pola usaha dan industri yang ada dengan hadirnya revolusi industri 4.0 dan perubahan yang terjadi akibat pandemi Covid-19. “Kita dalam kondisi seperti ini tidak ada pilihan selain kolaborasi dengan dunia usaha, seberat apapun tantangan ketenagakerjaan bisa dilalui dengan kolaborasi,” kata Menteri Ketenagakerjaan, Ida Fauziyah dalam keterangannya, Sabtu (20/3). Menurut Ida, selain revolusi industri 4.0 dan dampak

pandemi Covid-19, kolaborasi dengan dunia industri juga diperlukan untuk menjawab tantangan klasik ketenagakerjaan. Di antaranya adalah angkatan kerja yang mayoritas berpendidikan menengah ke bawah dan ketidaksesuasian antara permintaan dan penawaran di pasar kerja. Ida pun berharap, kolaborasi dengan pemangku kepentingan mampu memperkuat BLK. Tidak hanya dari sisi pelatihan dan sertifikasi, namun juga dari sisi penempatan. Selain kolaborasi, upaya lain yang dilakukan Kemenaker adalah menerapkan program transformasi BLK. Arah kebijakannya mengubah BLK

sebagai Balai Pelatihan Vokasi menjadi pusat pengembangan kompetensi dan produktivitas tenaga kerja yang berdaya saing di tingkat nasional dan internasional. “Agenda 6R yang perlu menjadi perhatian utama kita yaitu Reformasi kelembagaan, Redesain substansi pelatihan, Revolusi SDM, Revitalisasi fasilitas dan sarana prasarana, rebranding BLK, dan relationship,” paparnya. Sebelumnya, Ida mengingatkan, pengelola Balai Latihan Kerja di pusat dan daerah agar dapat menjawab kebutuhan tenaga kerja di dunia usaha dan dunia industri. Menurutnya jika BLK hanya

melahirkan pengangguran baru, maka lebih baik BLK tutup saja karena tidak ada gunanya. Oleh karena itu, Kemnaker terus mendorong pengelola BLK, terutama BLK milik Pemerintah daerah agar pelatihan yang dijalankan sesuai dengan kebutuhan dunia industri dan dunia usaha (Dudi) setempat, sehingga alumni pelatihan dapat langsung terserap ke pasar kerja. “Kalau BLK ternyata akan melahirkan pengangguran baru. Tutup saja BLK. Buat apa kalau pelatihan kita lakukan justru malah menambah pengangguran baru,” kata Ida. p michelle natalia

film kampanye kembali nonton di bioskop adalah meminta subsidi tiket bioskop dengan skema 1 tiket sama dengan 4 tiket. Subsidi ini untuk meminimalisasi kerugian bioskop dan membuat produser berani memasok kembali film. “Agar bioskop kembali ditonton juga bisa diberikan promo buy one get one free.” Dengan cara tersebut diharapkan bioskop kembali ramai dikunjungi, produksi film kembali bergairah, seluruh pekerja film bisa kembali bekerja dan

berpenghasilan. Dampaknya diharapkan ekosistem film kembali berputar, termasuk bidang usaha yang bergantung pada film, termasuk terbukanya lapangan pekerjaan baru. Adapun perkiraan anggaran yang dibutuhkan untuk program tersebut yang diusulkan insan film kepada KPC-PEN sebesar Rp500 Miliar. Anggota Komisi I DPR Nurul Arifin menilai stimulus yang diajukan oleh insan perfilman cukup masuk akal. Namun,

yang terpenting adalah efek domino jika usulan ini diterima. “Karena saya lihat bagi Bapak Airlangga selaku Menko, yang terpenting adalah bagaimana bantuan ini kelak jika terealisasi, dapat sampai kepada para pekerja industri perfilman di tingkat bawah, karena di situ ada berbagai macam profesi yang terkena langsung dampak pandemi,” pungkas Nurul. p mohammad atik fajardin/MNC Media/ rakhmat baihaqi

Kemenperin Dukung Target Penyerapan Garam Lokal JAKARTA - Kementerian Perindustrian (Kemenperin) mendukungpenambahanserapangaram rakyat oleh sektor industri. Langkah ini diperlukan untuk meningkatkan kesejahteraan para petani garam, sekaligus mendukung ketersediaan bahan baku garam bagi sektor industri. “Kebutuhan garam bagi sektor industri saat ini terus meningkat dengan produktivitasnya yang tinggi. Kami berharap, penyerapan garam berkualitas dari para petani garam dapat mendukungpemenuhankebutuhantersebut,” kata Menteri Perindustrian Agus Gumiwang Kartasasmita di Jakarta, Jumat (19/3). Dengan fasilitasi Kemenperin, dalam dua tahun terakhir pelaksanaan Memorandum of Understanding (MoU) antara kelompok petani garam dengan pelaku industri, garam yang terserap mencapai lebih dari 2 juta ton. Kemenperin menargetkan, penyerapan garam dari petani oleh sektor industri pada tahun 2021 dapat naik hingga mencapai 1,5 juta ton. “Kami juga mendorong penyerapan untuk garam dengan kualitas mulai K2, K1, hingga premium,” ujar Menperin. Di sisi lain, Agus mengungkapkan, kebutuhan garam sektor industri masih perlu dipenuhi dari impor. Namun, pelaksanaan impor garam tetap melewati proses yang ketat, termasuk audit untuk verifikasi kebutuhan garam oleh para pelaku industri. “Penentuan angka

impor garam sendiri telah melewati proses audit langsung ke industri penggunanya dan angkanya sudah sesuai dengan data BPS,” ujar Menperin. Selain itu, Kemenperin selalu mengevaluasi impor garam industrisetiapperiodetigabulan. “Kebutuhan impor meningkat karena ada tambahan investasi pada industri pengguna garam. Selain itu, terdapat peningkatan kebutuhan dari industri yang sudah ada,” tandasnya. Agus menyampaikan, total kebutuhan garam bagi sektor industri di tahun 2021 mencapai sekitar 4,6 juta ton. Kebutuhan terbesar ada pada industri makanan dan minuman, industri farmasi, industri kimia, serta industri pulp dan kertas. “Pemenuhan kebutuhan bahan baku dan bahan penolong garam impor mampu menciptakan nilai tambah bagi sektorsektor tersebut,” tegasnya. Industri kimia misalnya, mengimpor garam senilai USD54,8 juta dan mampu menciptakannilaitambahdalambentuk ekspor senilai USD12,5 miliar. Begitu juga dengan Industri Makanan-Minuman yang mengimpor garam senilai USD19,2 juta untuk bahan baku danpenolongindustrinya,mampu mengekspor produk sektornya senilai USD31,1 miliar. Karenanya, Agus menambahkan, agar penyerapan garam rakyat dapat terus meningkat dan sektor industri mendapat-

kan jaminan pemenuhan bahan baku, perlu sinergi yang baik untuk meningkatkan kualitas garam produksi lokal. “Ini adalah tugas lintas kementerian/ lembaga untuk mendorong peningkatan kualitas garam lokal sehingga memenuhi standar kebutuhan industri,” tegasnya. Sementara itu, Ketua Umum Asosiasi Industri Pengguna Garam Indonesia (AIPGI) Tony Tanduk mengatakan, pihaknya mengupayakan penyerapan hingga 1,5 ton pada tahun 2021 untuk garam lokal dengan kadar NaCl minimal 90%, atau naik 13,8% dari tahun sebelumnya. Langkah selanjutnya adalah berkoordinasi dengan Direktorat Jenderal Industri Kecil, Menengah,danAneka(IKMA)Kemenperin untuk mendata penyerapan garam oleh pelaku IKM. “Kami juga mulai berkoordinasi langsung dengan koperasi binaan Kementerian Kelautan dan Perikanan (KKP),” kata Tony. Ketua Umum Gabungan Pengusaha Makanan dan Minuman Seluruh Indonesia (Gapmmi) Adhi S Lukman berkomitmen untuk meningkatkan penyerapangaramrakyat,disampingtetap menggunakan garam impor. Kebutuhan bahan baku garam pada industri makanan dan minuman tersebut untuk tahun ini akanberkisar743.000ton.Angka itu lebih tinggi dari tahun lalu sebanyak 530.000 ton. p sudarsono

KPPU Akan Soroti Pengalihan Frekuensi Konsolidasi Operator Telekomunikasi JAKARTA - Komisi Pengawas Persaingan Usaha (KPPU) menilai bisa menyoroti pengalihan frekuensi dalam konsolidasi operator telekomunikasi. Pasalnya pengalihan frekuensi bisa menimbulkan persaingan tidak sehat. Seperti diketahui, salah satu isu dalam merger Indosat dan Tri adalah soal efisiensi pengalihan spektrum frekuensi.  Bila merger dilakukan tanpa harus mengembalikan frekuensi, maka dikhawatirkan ada potensi penguasaan spektrum frekuensi yang sangat besar hingga menyamai atau paling tidak mendekati

Telkomsel. Sedangkan jumlah pengguna gabungan ISAT-Tri hanya 96 juta, atau 56% dari pengguna Telkomsel yang mencapai 170 juta. Dengan frekuensi yang demikian besar dan jumlah pengguna yang hanya setengah dari Telkomsel, dikhawatirkan akan menggangu persaingan yang fair. Selain itu pengalihan frekuensi dalam merger ISAT-Tri dinilai kurang efektif untuk menciptakan efisiensi biaya. Bahkan justru menjadi pemborosan dan biaya tinggi sehingga merugikan konsumen. Komisioner Komisi Pengawas Persaingan Usaha (KPPU)

Guntur S Saragih menegaskan terdapat beberapa penilaian dalam notifikasi yang akan diperhitungkan pihaknya. Notifikasi atau pemberitahuan tertulis kepada KPPU sifatnya wajib dilakukan pelaku usaha yang melakukan merger. “Beberapa di antara penilaian adalah faktor konsentrasi pasar dan konsentrasi sumberdaya,” ujar Guntur saat dihubungi MNC Portal Indonesia di Jakarta belum lama ini. KPPU juga selalu mengimbau kepada pelaku usaha sebelum melakukan merger atau ker ja sama dapat melakukan konsultasi terlebih dahulu. Se-

hingga ini akan bersifat pre evaluation bukan post-evaluation.”Terkait dalam industri telekomunikasi, sumberdaya strategisnya adalah frekuensi. Jadi itu akan masuk hal-hal yang dinilai dalam notifikasi,” katanya. Sementara Ketua KPPU Kodrat Wibowo menambahkan, penguasaan frekuensi dapat menjadi bahan perhitungan atau pertimbanan untuk mengkaji apakah telah terjadi persaingan usaha tidak sehat di sektor telekomunikasi. “Jadi pertimbangannya tidak semata-mata jumlah pelanggan lagi dalam perhitungan penguasaan pasar. Penguasaan

frekuensi yang kini dapat dianggap sebagai aset sebuah perusahaan juga dapat menjadi dasar perhitungan,” kata Kodrat. Dia mencontohkan penguasaan frekuensi itu seperti perusahaan perkebunan yang menguasai aset tanah. Tanah itu sendiri merupakan aset yang tetap dimiliki negara tapi dikuasakan oleh korporasi, dalam hal ini perusahaan perkebunan. Bila perusahaan perkebunan itu merger atau bergabung maka luasan kebun yang dikuasai menjadi dasar perhitungan aset. “Jadi frekuensi itu sekarang dianggap sebagai aset, sama seperti tanah di perusahaan

perkebunan. Bila ada penggabungan berarti penguasaan aset secara total menjadi bertambah,” katanya. Sebelumnya, Analis Kebijakan Ahli Madya Kemenkominfo Adis Alifiawan mengatakan rencana pengalihan itu tetap harus mendapatkan persetujuan dari pemerintah, dalam hal ini Menteri Komunikasi dan Informatika, sebagai regulator. “Jadi tidak dilepas begitu saja. Karena antara dua perusahaan ada kecocokan, mereka langsung bisa membuat kesepakatan untuk melakukan pengalihan? Tidak seperti itu. Mereka harus minta persetujuan peme-

rintah,” jelasnya. Pengamat telekomunikasi Heru Sutadi juga pernah menyatakan aturan itu membuat pemerintah memiliki kontrol penuh atas frekuensi. “Karena masih ada evaluasi maka tidak sembarangan pengalihan frekuensi bisa dilakukan dan juga kerja sama pengguna frekuensi diimplementasikan,” ujar Heru.   Evaluasi harus dilakukan dengan parameter yang jelas, termasuk persaingan usaha yang sehat. “KPPU bisa terlibat dan dilibatkan dalam hal ini,” pungkas Heru. p hafid fuad

10

SENIN 22 MARET 2021

HeaLTHy & fit

Waspadai Reinfeksi Covid-19 Pandemi belum lagi usai, perkembangan penyakit saat ini malah amat dinamis. Terlebih pengobatan juga masih empirik, belum ada obat yang definitif. Hal tersebut diungkapkan oleh Spesialis Paru, dr Erlina Burhan dari Departemen Pulmonologi Kedokteran respirasi FKUI-RSUP Persahabatan. Yang dimaksud dengan perkembangan penyakit sangat dinamis adalah adanya kejadian mutasi virus, long covid , positif persisten, kan berarti kasus reinfeksi. “Belum ada pengobatan yang terbukti empiris, sifatnya masih sementara,” jelas dr Erlina dalam acara webinar dengan tema Kupas Tuntas Persiapan Menuju Era Post Covid yang diadakan PT Kalbe Farma Tbk beberapa waktu lalu. Jadi bagi penyintas jangan menjadi lalai dan menganggap dirinya kebal Covid-19. Pasalnya dr Erlina menekankan bahwa penyintas bisa kembali terinfeksi (reinfeksi). Mekanisme utamanya belum diketahui secara pasti namun sudah ada laporan reinfeksi terjadi karena dua virus dengan tipe yang berbeda yang telah dibuktikan dengan analisis genome. “Hal tersebut tidak menutup kemungkinan reinfeksi terjadi karena satu virus dengan tipe yang sama dan mengalami reaktivasi,” jelas dr Erlina. Untuk diketahui, antibodi yang terbentuk setelah terinfeksi Covid-19 akan menghilang setelah 3-12 bulan. Nah, yang menjadi masalah, infeksi sekunder ini bahkan dapat lebih berat terjadi. Mengapa? Sebab, kadar virus yang sangat tinggi pada infeksi kedua. Kemudian kemungkinan bahwa infeksi ulang disebabkan oleh virus yang lebih ganas. Serta adanya peningkatan respons imun terkait antibodi, yaitu di mana sel-sel imunitas yang memiliki reseptor Fc, terinfeksi virus yang mengikat

antibodi tertentu. “Mekanisme ini sudah terlihat sebelumnya pada betacoronavirus yang menyebabkan sindrom pernapasan akut yang parah,” beber dr Erlina. Ia mewanti-wanti bahwa pandemi belum selesai sehingga pencegahan menjadi hal yang utama. Salah satu upaya pencegahan yaitu dengan melakukan adalah vaksinasi dan selalu terapkan protokol kesehatan 5M (memakai masker, mencuci tangan, menjaga jarak, menjauhi kerumunan, dan mengurangi mobilitas) dan menjaga imunitas. “Semuanya masih sangat diperlukan untuk pencegahan Covid-19 dalam menjaga produktivitas dan menjalankan aktivitas seharihari, walaupun sudah divaksin,” tambah dr Erlina. Di sisi lain dr Cindiwaty Josito Pudjiadi MARS MS SpGK mengatakan, kebutuhan nutrisi sangat penting bagi kesehatan tubuh. “Tetap menjaga pola hidup sehat, konsumsi makanan yang bergizi, tidur yang cukup, olahraga teratur, dan konsumsi multivitamin untuk meningkatkan daya tahan tubuh dan melawan pandemi saat ini,” dr Cindiwaty. Konsumsi makanan bergizi harus mencakup makronutrien dan mikronutrien. Makronutrien meliputi karbohidrat, protein, dan lemak; sedangkan mikronutrien adalah makanan yang kaya akan vitamin dan mineral seperti sayur dan buah-buahan. Ia mengingatkan hati-hati berat badan menjadi bertambah pada masa pandemi ini. Bagaimana tidak, di rumah saja dan mengadopsi gaya hidup sedentary bisa membuat kadar

FOTO-FOTO : ISTIMEWA

Tips Tetap sehat saat pandemi Vaksin sudah tersedia, tinggal menunggu pendistribusiannya yang dilakukan bertahap. Tes pemeriksaan Covid-19 pun sudah banyak tersebar bahkan bisa dilakukan lewat layanan drive thru. Kendati demikian, masyarakat harus tetap disiplin terhadap protokol kesehatan, mulai dari kebiasaan umum (cuci tangan, gunakan masker, menjaga jarak), menjaga kesehatan lingkungan, dan menjaga kondisi tubuh. Berikut adalah beberapa tips agar tetap sehat di masa pandemi Covid-19 dari Kementerian Kesehatan RI:

Demi meyakinkan masyarakat bahwa vaksin efektif dalam mengendalikan pandemi, dr Dirga Sakti Rambe, Dokter Spesialis Penyakit Dalam/Vaksinolog menyampaikan, orang-orang yang divaksinasi memiliki risiko tiga kali lebih rendah mengalami Covid-19, dibandingkan dengan orang-orang yang tidak divaksinasi. “Pada situasi pandemi, ini, tiga kali lebih rendah ini sangat signifikan,” kata dr Dirga. Namun begitu, perlu diingat bahwa vaksinasi tidak serta-merta memberikan kekebalan tubuh dalam waktu singkat. “Dari hasil uji klinis, diketahui kekebalan optimal baru bisa didapatkan setelah 28 hari setelah penyuntikan,” terang dr Siti Nadia lebih lanjut. Oleh karenanya, sangat penting sekali vaksinasi dibarengi dengan kepatuhan tinggi terhadap prokes. Untuk mendapatkan proteksi optimal, vaksinasi harus bersama dengan 3M (memakai masker, menjaga jarak, dan mencuci tangan). “Bila itu kita lakukan dengan sungguh-sungguh, pandemi

l Kurangi konsumsi alkohol dan minuman bergula. l Lakukan aktivitas fisik 30 menit per hari agar tetap aktif dan bugar. l Jika bekerja di rumah, setiap duduk 30 menit beristirahatlah. l Stop merokok, merokok meningkatkan risiko infeksi dan akan memperparah komplikasi akibat Covid-19.

l Tetap di rumah saja. l Konsumsi makanan sehat untuk

lemak bertambah, berat badan meningkat, bahkan obesitas. Lemak viseral atau lemak aktif yang membalut organ-organ di ruang perut di dalam tubuh yang juga sering disebut lemak perut, haruslah diwaspadai. Tidak terkecuali lemak subkutan, yakni jenis lemak yang terletak di bawah lapisan kulit. Kedua lemak ini tentunya berbahaya bagi

Vaksinasi Tak Otomatis Kebal Covid-19

Upaya edukasi dan komunikasi kepada masyarakat harus dilakukan seimbang antara vaksinasi dan protokol kesehatan. Pasalnya, langkah penanganan pandemi Covid-19 tidak bisa dilakukan secara tunggal dengan vaksinasi, harus komprehensif dengan tetap melaksanakan protokol kesehatan (prokes) yang ketat demi menekan lebih banyak jumlah orang yang terinfeksi. Masyarakat perlu diingatkan terus-menerus tentang pentingnya prokes sebagai intervensi yang penting juga selain vaksinasi. “Sekitar 4 juta masyarakat Indonesia sudah menerima vaksin dosis pertama. Terutama untuk lanjut usia (lansia) yang sudah dimudahkan pelaksanaannya melalui banyak sekali sentra-sentra vaksinasi hasil kerja sama dengan seluruh elemen bangsa,” terang dr Siti Nadia Tarmizi MEpid, Juru Bicara Vaksinasi Covid-19 Kemenkes, dalam Dialog Produktif bertema Selaras Vaksinasi dan Protokol Kesehatan.

meningkatkan imunitas tubuh.

ini dapat segera terkendali,” tambah dr Dirga. Lebih jauh terkait vaksin ada kabar baik mengenai vaksin Covid-19 AstraZeneca. Vaksin ini akhirnya akan mulai didistribusikan untuk digunakan dalam program vaksinasi Covid-19 pemerintah. Badan Pengawas Obat dan Makanan menyatakan, vaksin AstraZeneca tidak terkait dengan risiko pembekuan darah atau kejadian penggumpalan darah secara keseluruhan (tromboemboli) pada mereka yang menerima vaksin. Badan POM juga menyatakan bahwa manfaat vaksin dalam penanganan Covid-19 lebih besar daripada risiko efek sampingnya. Sementara itu, Majelis Ulama Indonesia (MUI) juga menyampaikan bahwa vaksin AstraZeneca dibolehkan untuk digunakan (mubah) mengingat manfaat yang diberikan dari vaksin ini, serta dengan pertimbangan kondisi darurat yang terjadi saat ini akibat pandemi Covid-19. MUI juga menyatakan, umat Islam di Indonesia wajib mengikuti program vaksinasi pemerintah agar kita semua segera keluar dari pandemi. Dalam keterangan pers diberitahukan bahwa vaksin Covid19 AstraZeneca merupakan vaksin vektor virus yang tidak mengandung produk berasal dari hewan, seperti yang telah dikonfirmasikan oleh Badan Otoritas Produk Obat dan Kesehatan Inggris. Semua tahapan proses produksinya, vaksin vektor virus ini tidak menggunakan dan bersentuhan dengan produk turunan babi atau produk hewani lainnya. Vaksin ini telah disetujui di lebih dari 70 negara di seluruh dunia. psri noviarni

l Jika Anda stres, bingung, dan takut, bicarakanlah perasaan Anda kepada orang

kesehatan. Pada kesempatan itu dr Cindiwaty menerangkan peran vitamin D dalam sistem imun. Di antaranya mendukung kesehatan saluran cerna, melindungi paru dari infeksi, meningkatkan perlindungan sel kornea (mata), serta menjaga fungsi ginjal, dan meningkatkan imunitas tubuh. Terkait webinar yang

yang dikenal dan dipercaya dapat membantu. Jika diperlukan, Anda bisa berkonsultasi dengan spesialis kesehatan jiwa yang akan memberikan penanganan tepat. l Saling menguatkan di antara keluarga, tetangga, dan teman. Rasa kasih sayang juga menjadi obat. l Beribadah, baca buku, dengarkan musik, dan jangan cemas. l Dengar dan ikuti anjuran pemerintah yang disiarkan resmi setiap hari. psri noviarni

diselenggarakan Kalbe ini, Vidi Agiorno Metupawan selaku Group Product Manager PT Kalbe Farma Tbk Kalbe menuturkan, pihaknya berkomitmen dalam memberikan edukasi kesehatan guna meningkatkan pengetahuan dan kesadaran kepada masyarakat dalam menjaga kesehatan mulai pencegahan hingga pengobatan. “Di tengah pandemik Covid-19

ini, banyak masyarakat yang harus tetap beraktivitas dengan memperhatikan protokol kesehatan. Oleh karena itu, kita harus bisa menjaga kesehatan dan daya tahan tubuh dengan konsumsi nutrisi sehat, rutin olahraga, dan memenuhi kebutuhan multivitamin,” tutup Vidi. psri noviarni

penderita Hipertensi dan Obesitas Berisiko Long Covid Pasien Covid-19 seharusnya mengalami pemulihan setelah 2-6 minggu. Namun pada beberapa orang, beberapa gejala dapat bertahan atau muncul kembali setelah berminggu-minggi hingga berbulan-bulan setelah pulih. Di antara usia 18-34 tahun dengan kesehatan yang baik, sekitar 20% dilaporkan mengalami prolonged symptoms . Beberapa gejala yang dirasakan antara lain kelelahan, batuk, sesak napas, anosmia, ageusia (penurunan indra pengecapan), diare, mual, sakit kepala, nyeri badan, nyeri abdomen, dan nyeri dada, hingga kebingungan. “Faktor risiko mereka yang mengalami long covid adalah orang dengan hipertensi, obesitas, dan kondisi kesehatan mental,” urai Spesialis Paru dr Erlina Burhan dari departemen Pulmonologi Kedokteran respirasi FKUI-RSUP Persahabatan. Ia juga menjelaskan mengapa pasien Covid-19 yang sudah tak merasakan gejala dan sudah lewat masa dua minggu tetapi hasil tes PCR-nya masih positif. Dr Erlina mengatakan, kondisi ini disebut dengan istilah positif persisten. Alat PCR masih dapat mendeteksi komponen virus yang sudah inaktif. Menurut dia, kondisi ini disebabkan mesin PCR yang sangat sensitif sehingga tak bisa membedakan komponen virus aktif. “Sudah sembuh tak ada gejala, tapi pas dilakukan PCR masih positif. PCR ini sangat sensitif, bisa bedakan komponen virus tapi tidak bisa bedakan ini aktif atau nggak aktif,” bebernya. Penelitian di Korea menemukan bahwa walaupun sudah tidak ditemukan virus yang dapat bereplikasi tiga minggu

setelah onset gejala pertama di tubuh pasien, SarsCov 2 RNA masih terdeteksi di spesimen pemeriksaan PCR hingga 12 minggu. Jika nilai CT-nya tinggi kalau sudah 14 hari dan tidak ada gejala, kalaupun terdeteksi oleh PCR, itu adalah sisa virus, partikel, atau bangkai virus yang bisa terdeteksi oleh PCR. Nilai CT atau cycle threshold value dalam beberapa jurnal disebutkan bahwa nilai CT ini berbanding terbalik dengan kemampuan virus untuk menular ke orang lain. Artinya, semakin tinggi nilai CT, semakin rendah kemungkinan virus untuk menyebabkan infeksi. “Dengan demikian, sebetulnya kalau sudah tidak ada gejala, sudah 14 hari, maka virus sudah tidak (berpotensi) menulari. Tentunya didukung dengan bukti PCR yang tinggi,” jelas dr Erlina. Walau sudah tidak lagi terinfeksi maupun berisiko menularkan virus kepada orang lain, dr Erlina tetap menyarankan agar pasien tersebut

tetap berpegang pada aturan protokol kesehatan. Jangan lalu menjadi abai dengan alasan sudah tidak berisiko lagi. Aturan 3M, yakni memakai masker, menjaga jarak, dan mencuci tangan secara berkala. Pusat Pengendalian dan Pencegahan Penyakit (CDC) menyebutkan, kebanyakan orang yang sudah menjalani isolasi mandiri selama 10 hari sejak memiliki gejala, dinyatakan sudah bersih. Dr Amesh Adalja, dokter penyakit infeksi dari Johns Hopkins University Center, mengatakan ada dua cara untuk mengetahui apakah pasien Covid-19 sudah benar-benar aman untuk berkumpul dengan orang lain. Yang pertama adalah dengan mengevaluasi gejala. “Cara termudah adalah menunggu 10 hari dari onset gejala pada kasus ringan hingga sedang (lebih dari 20 hari pada kasus berat) barulah bisa berhenti isolasi mandiri,” kata Adalja dikutip dari Healthline . psri noviarni

11

SENIN 22 MARET 2021

FASHION

Perhiasan Mewah Ratusan Juta di Grammy Awards 2021 Sejumlah penyanyi papan atas tampil glamor dengan perhiasan mewah di karpet merah Grammy Awards 2021 beberapa waktu lalu. Perhiasan mewah tersebut berasal dari label high end. Cynthia Erivo yang dinominasikan penghargaan untuk kategori lagu terbaik dari film Stand Up tampil menawan mengenakan penjepit telinga berlian ikonik Tiffany & Co Schlumberger jenis Mellon dalam bahan platinum dan emas 18 karat. “Perhiasan tersebut oleh Cynthia dipasangkan dengan gaun sutra perak dan emas yang edgy dari Louis Vuitton,” ujar Fashion Editor Paige Reddinger seperti dilansir dari robbreport.com . Dia melengkapi penampilannya dengan Tiffany & Co Curb Link Bracelet dan pilihan cincin berlian Tiffany & Co Schlumberger dan Tiffany T1. Lalu, pemegang nominasi, termasuk untuk Album R&B Progresif Terbaik untuk Ungodly Hour, Chloe x Halle masingmasing juga mengenakan perhiasan dari Tiffany & Co. Chloe Bailey tampil di wardrobed dengan anting-anting ganda Tiffany HardWear berdesain long link berbahan emas 18 karat. Dia melengkapi penampilannya dengan gelang Tiffany T1, gelang tautan Tiffany HardWear 18 karat, dan sebuah cincin berlian Tiffany Victoria. Cincin ini memiliki desain bergantian dari platinum dengan berlian. Sementara itu, Halle Bailey mengenakan anting dan gelang

cluster drop campuran Tiffany Victoria dalam warna rose gold . Dia juga mengenakan gelang berengsel berlian lebar Tiffany T T1 dan cincin berlian Tiffany T1 dengan berlian berukuran 4,5 mm. Pembawa acara Grammy, Trevor Noah, mengenakan bros Tiffany & Co Schlumberger Apollo yang memesona. Bros ini terbuat dari emas kuning 18K dan platinum dengan berlian. Bros berdesain Lapel diperkirakan senilai USD35.000 atau Rp490 juta. “Bros ini merupakan aksen yang sempurna dan

berselera tinggi pada tuksedo Gucci hitam kustomnya,” ujar Reddinger. Sementara itu, penyanyi Lizzo menghadiri acara penghargaan sebagai presenter dan datang mengenakan kalung berlian Bulgari. Penyanyi yang juga dikenal sebagai rapper , penulis lagu, dan pemain suling ini mengenakan tujuh potong perhiasan ikon merek Serpenti dan dua cincin perhiasan. “Di lehernya dia

mengenakan set kalung Serpenti emas putih dengan satu berlian berbentuk buah pir (1,15 karat), 37 berlian potong pir (7,91 karat), dan berlian pavé (42,67 karat),”

ujar Reddinger. Di telinganya ada sepasang anting-anting emas putih dan berlian dengan total 5,11 karat. Sementara di pergelangan

SEPUTAR GRAMMY PENYELENGGARAAN ACARA Acara Grammy Awards 2021 berjalan dengan lancar pada 14 Maret langsung dari Los Angeles Convention Center. Banyak artis turut berpartisipasi dalam berbagai kategori acara tahunan ini. NOMINASI Di Grammy Awards 2021, banyak penyanyi yang mendapatkan nominasi, mulai Beyoncé yang mendapatkan sembilan nominasi, Megan Thee Stallion, Jhené Aiko, Post Malone, Billie Eilish, hingga Roddy Rich. Kemenangan ke-28 Beyoncé di Grammy menjadikan ia perempuan dengan rekor penghargaan paling banyak dalam sejarah Grammy. KEMENANGAN LADY GAGA DAN ARIANA GRANDE Kemenangan Lady Gaga dan Ariana Grande dengan lagunya Rain on Me sebagai best pop duo/group performance memang bukan sesuatu yang mengejutkan, mengingat lagu ini memang jadi lagu yang sangat populer di mana-mana. BTS MENJADI NOMINASI PEMENANG Masuknya BTS, boyband asal Korea Selatan ke nominasi Grammy Awards merupakan sebuah pencetakan sejarah. Sebelumnya, belum pernah ada boyband asal negara itu yang masuk Grammy. BTS adalah salah satu nominee yang digadanggadang jadi pemenang.

tangannya, dia memakai dua gelang emas putih dan berlian dengan total 6,18 karat. Cincinnya, termasuk satu cincin berlian Serpenti emas putih dan dua cincin berlian perhiasan tinggi platinum, mencapai total 28,67 karat. Adapun Megan Thee Stallion tidak hanya membawa pulang tiga Grammy Awards untuk kategori artis pendatang baru terbaik, penampilan rap terbaik, dan lagu rap terbaik, tetapi dia juga datang berpakaian untuk acara itu dengan perhiasan dari label Chopard. Sorotannya adalah kalung berlian dari koleksi Read Carpet maison, yang menampilkan 91,70 karat berlian yang bertatahkan emas putih 18 karat, dan gelang berlian 83,42 karat yang ditatah dengan emas putih 18 karat dari perusahaan Green. Dia melengkapi penampilannya dengan 33,8 karat berlian berbentuk buah pir yang ditatah dengan emas Fairmined putih 18 karat. Terlihat pula cincin berlian bundar seberat 3,31 karat yang dikelilingi oleh berlian 6,47 karat, juga diatur dalam emas Fairmined putih 18 karat. Selain Megan Thee Stallion, penyanyi lain yang mengenakan perhiasan dari label Chopard adalah Ingrid Andress. Penyanyi musik country ini dinominasikan sebagai artis pendatang baru terbaik. Malam itu dia menggunakan setelan Armani Privé putih mencolok yang dibiarkan terbuka untuk mengungkapkan kalung yang mengalir di dadanya yang terbuat dari kristal. Anting Chopard-nya dihiasi dengan berlian 21,59 karat yang dilapisi emas putih dari koleksi Red Carpet. Dia juga mengenakan beberapa cincin termasuk yang terbuat dari 2,67 karat berlian yang dilapisi dengan emas putih 18 karat dan berlian 1,32 karat yang diatur dalam emas putih 18 karat dari koleksi Precious Lace perhiasan yang baru. p dwi nur ratnaningsih

FOTO-FOTO: ISTIMEWA

IUIGA DAN ATOME

Belanja Produk Perlengkapan dengan Mudah

DOK IUGIA

IUIGA, toko perlengkapan serba-ada memberikan fasilitas baru yakni dengan memperkenalkan metode pembayaran cicilan 0% tenor hingga 6 bulan. “Permintaan metode pem-

bayaran dengan cicilan sudah kami terima sejak kuartal akhir 2020. Sejak itu, kami melakukan riset untuk memilih mitra pembayaran terbaik dengan metode cicilan. Proses pemilihan ini membutuhkan waktu yang cukup panjang demi memberikan pelayanan terbaik untuk konsumen,” ujar William Firman, Managing Director IUIGA Indonesia. Atome merupakan penyedia layanan pembayaran dengan metode cicilan yang pertama kali diluncurkan di Singapura sejak 2019. Atome telah hadir di

Indonesia sejak pertengahan 2020 dan telah bermitra dengan lebih dari 650 retailer online dan offline . Aplikasi Atome dapat di-download di Google Play atau cukup dengan melakukan scan QR code pada kasir bagi para pengguna iOS. “Kami sangat senang dan bangga menjadi salah satu partner IUIGA sebagai penyedia pembayaran dengan metode cicilan kepada masyarakat di Indonesia. Jika IUIGA menawarkan transparansi harga akan setiap produknya, kami menawarkan

transparansi bunga dan tempo pembayaran sebelum konsumen kami melakukan persetujuan pembelian,” ujar Meri Ui, Executive Director Atome Indonesia. Dalam acara peluncuran kemitraan ini, turut dihadiri oleh beberapa influencers dengan mencoba berbelanja IUIGA dengan Atome. Mereka yakni Beauty, lifestyle, dan parenting. Influencers yang hadir yaitu Namira Adzani, Dea Rizky, Putri Aulia, dr Irani Vianza, dan Youra Bellvina. p dwi nur ratnaningsih

KAMI Menggandeng Influencer Malaysia untuk Koleksi Minira Kolaborasi sebuah brand semakin sering dilakukan untuk menjadi daya tarik konsumen. Hal tersebut dilakukan oleh KAMI yang menggandeng presenter TV, pengusaha, dan influencer Malaysia, Farahanim Razak untuk koleksi scarf . Ini adalah kali pertama bagi KAMI berkolaborasi dengan influencer Malaysia, sejak keberadaan KAMI di Malaysia pada 2013. Kolaborasi unik ini tertuang dalam bentuk scarf , yang diberi nama MINIRA. Kata MINIRA berasal dari kata ominira atau kebebasan dalam bahasa Yoruba. Nadya Karina atau akrab disebut Karin, Creative Director & Co-Founder KAMI, dalam acara peluncuran koleksi MINIRA secara virtual, beberapa waktu lalu menjelaskan, “Pola scarf MINIRA terinspirasi dari keindahan bunga kembang sepatu. Hibiscus atau bunga raya adalah bunga spesial di Malaysia seperti yang umumnya kita kenal. Bunga raya yang memiliki arti “bunga perayaan” merupakan simbol cinta kelahiran

Malaysia,” jelasnya. Dia juga menambahkan, pada 1960, kembang sepatu dideklarasikan sebagai bunga nasional oleh Perdana Menteri Tunku Abdul Rahman Putra AlHaj. Kelima kelopak bunga tersebut sangat cocok dengan lima prinsip Rukun Negara. “Warnawarna cerah dari bunga ini melambangkan keberanian. Kembang sepatu biasanya mekar di seluruh Malaysia. Banyak yang menghiasi pagar rumah penduduk di sana, “kata Karin. “Tidak hanya keindahannya, kekuatan yang ada pada bunga raya

juga menjadi inspirasi koleksi ini. Jika wanita diibaratkan sekuntum bunga, hibiscus menggambarkannya dengan sempurna. DOK KAMI Koleksi ini dibuat dengan harapan setiap wanita yang memakainya ingat, bahwa kekuatan selalu diikuti oleh kecantikan,” tambah Karin. Koleksi scarf MINIRA hadir dalam empat warna, yaitu bold dan pastel. Ada dua warna bold , yaitu deep emerald yang didominasi warna biru tua kehijauan dengan kombinasi bunga hibiscus berwarna oranye, dan satunya lagi granada red yang didominasi warna merah marun dengan bunga hibiscus berwarna biru. Untuk varian pastel, tersedia dalam dua pilihan warna, yakni roses ash yang memiliki sentuhan warna

Brand Cole Haan Kini Ada di Jakarta

pink dan blue sand versi biru pastel. Perpaduan warna pastel dan bold ini juga merepresentasikan karakter Farahanim dan karakter wanita identik dengan kelembutan, tetapi jauh di dalam diri wanita yang juga bisa sangat tangguh. Scarf MINIRA , akan diluncurkan lebih awal di KAMI Malaysia, kemarin dan selanjutnya akan tersedia di seluruh store KAMI di Indonesia. “Kami berharap kolaborasi lintas negara ini bisa diterima baik oleh pasar Malaysia dan Indonesia, dan dapat menginspirasi perempuan dari kedua negara ini,” ujar Elia Izzati, Pemilik KAMI Malaysia. “Melalui kerja sama ini, akhirnya KAMI berkesempatan untuk meningkatkan permainannya ke pasar yang lebih luas, khususnya Malaysia. Kami yakin pengaruh Farahanim dalam kolaborasi ini memberikan sentuhan berbeda,” tambah Istafiana Candarini, Director and Co-Founder of KAMI p sali pawiatan

DOK COLE HAAN

Brand sepatu Cole Haan yang didirikan pada 1928 kini sudah ada di Indonesia. Gerai pertamanya di Grand Indonesia Jakarta dibawa oleh Kanmo Group. Saat ini merek asal Amerika ini memprioritaskan sistem Grand 360 Design dan Engineering di seluruh koleksinya, terutama di koleksi terlaris , ZERØGRAND. Adrian Santos, Senior Vice President, International di Cole Haan, mengatakan, “Kami sangat senang mengumumkan kemitraan kami dengan Kanmo Group, distributor utama merek fashion global, Cole Haan di Indonesia. Pembukaan toko pertama kami di Indonesia merupakan momen penting bagi kami, karena ini merupakan toko GRANDSHØP ke-30 di luar Amerika Utara,” jelasnya dalam rilis yang diterima KORAN SINDO . Gerai flagship seluas hampir 100m2 menampilkan teknologi produk Cole Haan yang paling inovatif, termasuk koleksi ZERØGRAND yang ikonik. Interior gerai dibuat secara strategis minimalis, modular dan mobile , dirancang untuk memprioritaskan

koleksi yang menggabungkan inovasi dan gaya untuk menciptakan pengalaman luar biasa bagi pelanggan. Konsep GRANDSHØP di Grand Indonesia ini terinspirasi dari pelanggan Indonesia yang energik dan aktif. “Kami sangat senang membuka gerai flagship Cole Haan pertama di Jakarta. Kami menyediakan alas kaki dan aksesori yang bisa dipakai mulai bekerja, berolahraga, hingga kegiatan akhir pekan,” jelas Manoj Bharwani, CoFounder Kanmo Group. Koleksi Musim Semi 2021 termasuk Øriginal Grand Energy Oxfords dan ZERØGRAND Radiant Sneakers wanita juga ada di toko tersebut. ØriginalGrand Energy Oxfords Pria dan Wanita dibuat dengan teknologi GRANDFØAM milik Cole Haan untuk menciptakan sistem bantalan yang dapat meredam guncangan serta responsif ketika dikenakan sepanjang hari. ZERØGRAND Radiant Sneaker wanita merupakan koleksi yang sporty dan chic , dibuat secara hand-crafted dengan detail kulit, athletic mesh, dan bahan karet. p sali pawiatan

12

SENIN 22 MARET 2021

FRAME

Listrik Tenaga Surya Terangi Desa Samangki edan terjal serta akses jalan yang rusak dan sempit menjadikan Desa Samangki, Kecamatan Simbang, Kabupaten Maros, Sulawesi Selatan masih tergolong terisolasi dari pusat pemerintahan. Desa yang berada dalam kawasan hutan negara dan Taman Nasional BantimurungBulusaraung ini memiliki luas wilayah 43, 62 km2 dengan jumlah penduduk sebanyak 5.176 jiwa pada 2017. Desa ini juga dikenal sebagai desa tujuan wisata karena terdapat sejumlah taman wisata alam yang

M

masih terjaga kelestariannya serta memiliki sejumlah gua yang masih alami. Masyarakat desa yang sebagian besar berprofesi sebagai petani tersebut selama puluhan tahun tidak pernah mendapatkan aliran listrik. Pada malam hari Desa Samangki gelap gulita dan warga hanya mengandalkan lampu teplok sebagai alat penerangan. Aliran listrik baru menyentuh desa tersebut pada akhir 2015 lalu setelah pemerintah memberikan bantuan pembangkit listrik tenaga surya (PLTS) kepada masyarakat. Saat ini setiap rumah mendapatkan suplai listrik 300 watt selama 8 hingga 12 jam per hari. p

FOTO DAN TEKS KORAN SINDO / MUCTAMIR ZAIDE

Panel solar cells berada di antara rumah penduduk di Desa Samangki yang masih terisolasi.

Sejumlah rumah penduduk terlihat di atas perbukitan di Desa Samangki, Kecamatan Simbang, Kabupaten Maros, Sulawesi Selatan menyambut malam.

Petugas melakukan pemeriksaan rutin pada panel solar cells.

Anak-anak riang gembira saat bermain di depan Pembangkit Listrik Tenaga Surya (PLTS) Desa Samangki.

Listrik menerangi salah satu rumah panggung berhiaskan bintang-bintang yang menerangi malam. Desa Samangki belum difasilitasi listrik PLN karena akses menuju desa tersebut masih sulit dijangkau karena jalan yang rusak, sempit, dan terjal.

Listrik tenaga surya menerangi salah satu warung kelontong di Desa Samangki.

Pemuda desa mengakses internet melalui ponsel saat menikmati malam yang indah dari puncak bukit.

13

SENIN 22 MARET 2021

rAGAM Tanam Pohon di Kawasan Hijau GBK Menteri Sekretaris Negara (Mensesneg) Pratikno menanam pohon disaksikan Menteri Hukum dan Hak Asasi Manusia Yasonna H Laoly (kiri), Menteri Sosial Tri Rismaharini (kanan), dan Wakil Ketua MPR Ahmad Basarah (dua kanan) pada acara aksi tanam pohon di ruang publik Gelora Bung Karno (GBK), Jakarta, kemarin. Sebanyak 24 jenis pohon ditanam di kawasan GBK untuk menjaga konsep kawasan hijau dan ruang publik yang dibangun pada era Presiden Soekarno. KORAN SINDO/YULIANTO

Usai Kalahkan Pecatur Dunia, Dadang Siap Ladeni GM Irene BANDUNG– Belakangan dunia maya digegerkan oleh sosok Dewa Kipas yang dituding berbuat curang setelah mengalahkan pecatur dunia asal Amerika Serikat Levi Rozman di platform laga catur virtual, Chess.com. Dewa Kipas merupakan nama akun yang digunakan oleh pria yang diketahui sebagai warga Bandung bernama Dadang Subur saat melawan Levi Rozman. Akibat dituding curang, akun Dewa Kipas pun di-bannedChess.com. Dadang Subur tercatat sebagai warga Kelurahan Pungkur, Kecamatan Regol, Kota Bandung. Mantan pegawai salah satu BUMN itu mengaku mengenal dan bermain catur sejak duduk di bangku SMP. Kepiawaiannya bermain catur dia peroleh secara autodidak melalui buku-buku teori catur. Dadang juga mengaku, sejak mengenal catur, kerap bermain dengan orang dewasa untuk mengasah langkah dan strateginya dalam bermain catur. “Saya dulu kan belajar dari SMP pertamanya, autodidak. Terus ketemu teman dikasih buku teori, beberapa buku saya pelajari,” tutur Dadang Subur mengisahkan awal mula dirinya kenal dengan permainan catur di kediamannya, Jumat (19/3).

Kenal dan mulai suka dengan catur, Dadang kemudian memutuskan menjadi bagian klub catur Ganesha ITB binaan Dr Kusno, Iis Aisyah, dan Abdurachman. Setelahnya Dadang pindah ke klub catur Wibawa Mukti besutan Pemerintah Kotamadya Bandung. Di klub itu Dadang bahkan dipercaya menjadi wakil bendahara. Menurut Dadang, saat digembleng di klub catur Wibawa Mukti, dirinya pun kerap bertemu para grand master catur seperti Wawan Setiawan, Deni Sanjaya, Purnama hingga Roni Lukman. Tidak hanya itu, Dadang mengaku pernah belajar bermain catur bersama grand master catur pertama Indonesia, Herman Suradiradja. “Saya juga pernah belajar dari Pak Herman Suryadiraja karena tetanggaan. Pamannya Nia Daniati. Idola saya juga. Pak Herman bisa lawan ratusan (secara) simultan,” ungkapnya. Disinggung soal julukan Dewa Kipas, Dadang mengaku nama tersebut disematkan oleh rekannya, seorang peng-

usaha saat dirinya bekerja sebagai pegawai BUMN di Singkawang, Kalimantan Barat. Kala itu kata Dadang kerap menjadi kuda hitam dalam permainan pingpong setelah kerap berlatih pingpong dengan atlet-atlet pingpong kawakan. Bat pingpong yang digunakannya kebetulan bermerek DHS Hurricane King. “Dulu saya suka main pingpong di Singkawang. Dulu latihan pakai robot, tangan itu terus bergerak kalau seratus mukul, seratus menang. Enggak boleh miss kanan dan kiri, terus diajarin servis, terus nerimaservis,” kenang Dadang. Melihat kepiawaian Dadang bermain pingpong dan bat yang digunakannya, sang rekan pengusahanya itu lantas menjulukinya Dewa Kipas. Sejak saat itu julukan Dewa Kipas akhirnya melekat hingga kini. “Coba Pak Dadang lihat batnya, inilah si Dewa Kipas,” ujar Dadang menirukan ujaran rekan pengusahanya tersebut kala itu. Di balik kisah tersebut, Dadang kini tengah dihadapkan dengan sebuah tantangan besar untuk berhadapan dengan grand master catur Indonesia, Irene Kharisma. Diketahui, nama Irene Kharisma muncul di tengah polemik tudingan Dadang curang hingga polemik kemudian semakin

ISTIMEWA

Dadang Subur alias Dewa Kipas, warga Kota Bandung yang sukses menumbangkan pecatur dunia Levi Rozman hingga membuat geger dunia maya.

besar dan mendapat sorotan masyarakat luas. Hal itu tak lepas dari tudingan Irene yang juga menyebut keahlian Dadang bermain catur bohong. Tudingan tersebut disampaikan Irene melalui podcast Deddy Corbuzier yang memang sejak awal menyoroti kasus tudingan curang yang dialamatkan kepada Dadang. Deddy akhirnya mengajak Dadang dan Irene untuk bertanding langsung di atas papan catur hingga keduanya pun sepakat berlaga untuk membuktikan keahlian Dadang bermain catur sekaligus membuktikan benar tidaknya Dadang berbuat curang.

Dadang tak memiliki persiapan khusus untuk menghadapi Irene. Bahkan Dadang mengaku baru membeli papan catur agar dirinya tak cang gung saat berhadapan dengan Irene. Pasalnya, kata Dadang, selama ini dirinya hanya bermain catur secara virtual. Dadang mengaku kesiapan dirinya menghadapi Irene tak lepas dari ajakan Deddy Corbuzier. “GM Irene itu bagus. ELO dia lebih tinggi. Tapi kalau yang ngajak Pak Deddy Corbuzier ya sudah. Saya akan berusaha semaksimal mungkin, mudahmudahan bisa mengimbangi,” katanya. pagung bakti sarasa

Jajaran Direksi PT Pos Indonesia Dirombak JAKARTA – Menteri Badan Usaha Milik Negara (BUMN) Erick Thohir mengubah nomenklatur, melakukan pengalihan tugas, dan menambah nomenklatur Direksi PT Pos Indonesia (Persero) dalam rapat umum pemegang saham (RUPS). Salah satunya mengangkat Siti Choiriana sebagai Direktur Bisnis Kurir dan Logistik PT Pos Indonesia (Persero) yang baru. Dalam keterangan tertulis yang diterima KORAN SINDO, Siti Choiriana lahir di Magetan pada 28 Mei 1970. Siti Choirina meraih gelar Sarjana Teknik Elektro dan Magister Manajemen Teknologi lulusan Institut Teknologi Sepuluh November (ITS) Surabaya. Sebelumnya Siti Choirina menjabat sebagai direktur Consumer Service Telkom Indonesia. Wanita yang akrab dengan sapaan Ana ini pernah meraih penghargaan platinum winner anugerah Kartini BUMN 2014. Mengenai perubahan nomenklatur, Menteri Erick mengubah nomenklatur, melakukan pengalihan tugas direktur, dan menambah satu nomenklatur, yakni Direktur Operasi dan Teknologi Informasi. Keputusan itu berdasarkan Surat Keputusan Menteri Badan Usaha Milik Negara nomor SK-91/MBU/03/2021 Tanggal 18 Maret 2021 tentang Per-

ubahan Nomenklatur Jabatan, Pengalihan Tugas dan Pengangkatan Anggota-Anggota Direksi Perusahaan Perseroan (Persero) PT Pos Indonesia. Erick memutuskan mengubah tiga nomenklatur jabatan para anggota direksi perusahaan perseroan PT Pos Indonesia, yakni Direktur Kurir dan Logistik menjadi Direktur Bisnis Kurir dan Logistik, Direktur Jaringan dan Layanan Keuangan menjadi Direktur Bisnis Jaringan dan Layanan Keuangan, dan Direktur Keuangan menjadi Direktur Keuangan dan Manajemen Risiko. Erick melakukan pengalihan tugas Hariadi dari sebagai direktur Kurir dan Logistik menjadi direktur Operasi dan Teknologi Informasi, Charles Sitorus dari direktur Jaringan dan Layanan Keuangan menjadi direktur Bisnis Jaringan dan Layanan Keuangan. BerikutinisusunandireksiPT Pos Indonesia. Direktur Utama Faizal Rochmad Djoemadi, Direktur Bisnis Jaringan dan Layanan Keuangan Charles Sitorus, Direktur Keuangan dan Manajemen Risiko Endy Pattia Rahmadi Abdurrahman, Direktur Operasi dan Teknologi Informasi Hariadi, Direktur Kelembagaan Nezar Patria, Direktur Bisnis Kurir dan Logistik Siti Choiriana. psudarsono

Wali Kota Surabaya Jadi OTAS Komodo-Gajah SURABAYA – Wali Kota Surabaya Eri Cahyadi resmi menjadi orang tua asuh satwa (OTAS) komodo dan gajah. Sementara Wakil Wali Kota Surabaya Armuji  menjadi bapak asuh satwa jalak bali. “Semua yang hadir di sini sangat cinta Surabaya. Alhamdulillah ini yang saya impikan, kekuatan kota adalah gotong-royong,” kata Eri di Surabaya kemarin. Dia melanjutkan, gotongroyong seperti saat ini harus terus berjalan dan semakin dipererat sehingga ketika ada kendala apa pun dapat terselesaikan dengan baik. Selain Eri dan Armuji, pada saat yang sama salah seorang undangan di Kebun Binatang Surabaya spontan memutuskan bersedia menjadi bapak asuh satwa dengan paket platinum senilai Rp450 juta per tahun. “Ini begitu bangganya saya dengan pengusaha Surabaya, Badan Usaha Milik Daerah (BUMD), dan Badan Usaha Milik Negara (BUMN).Semogainiadalahawal yang baik dari gotong-royong kita untuk bersama melewati masa pandemi korona (Covid19),” bebernya. Dia pun berharap, bagi para tamu undangan yang menjadi bapak atau ibu asuh satwa, upaya itu akan menjadi ladang pahala dan amal jariah. Sebab

satwa-satwa itu akan memperoleh pakan dengan standar nutrisi yang terjaga, akses perawatan medis, dan berlandaskan kaidah konservasi. “Semoga kebaikan panjenengan (Anda) akan tercatat sebagai amal jariah dan menjadi ladang pahala bagi Anda semuanya,” ungkap Wali Kota. Mantan Kepala Badan Perencanaan Pembangunan Kota (Bapekko) menegaskan akan terus mempercantik Kebun Binatang Surabaya (KBS). Mulai dari beberapa waktu lalu dia telah berkomunikasi intens dengan perguruan tinggi untuk berkolaborasi. Seperti hasil pertemuannya dengan Universitas Airlangga (Unair) beberapa waktu lalu, Eri berkolaborasi dengan Fakultas Kedokteran Hewan (FKH). “Insyaallah mahasiswa datang ke sini praktik membantu memeriksa satwa secara berkala. Jika dihitung total ada 212 spesies dan lebih dari 2.000 satwa,” ungkapnya. Tidak hanya itu, dia pun mengaku telah berkoordinasi dengan Universitas Negeri Surabaya (Unesa) akan membuat pertunjukan tampilan tiap akhir pekan, yakni kesenian dari mahasiswa Seni Drama Tari Musik (Sendratasik). paan haryono

Saat Batik Jawa Barat Goes to New York HAFID FUAD

Jakarta

andemi menjadi sekolah terbaik bagi pelaku usaha UMKM  untuk berinovasi. Konsep utama ini yang diperjuangkan pendiri Komunitas UMKM Alumni Unpad Dewi Tenty yang kini menghimpun UMKM batik Jawa Barat untuk memenuhi permintaan dari butik di New York. Total ada 700 UMKM alumni Unpad yang tergabung dalam per-kumpulan ini. Sebuah jejaring butik, Sasmita Batik, milik WNI di AS sudah menyatakan siap untuk menjualkan batik dari Jawa Barat. Butik tersebut menawarkan ke berbagai produsen dressbatik modern Jawa Barat untuk bisa masuk ke pasar AS. Jaringan toko di sana sudah siap. Tersebar di Nashville, Ohio, dan Buffalo. Pusatnya di Buffalo, negara bagian New York. Konsepnya produk batik cantik untuk pakaian seharihari, khususnya untuk musim panas (summer). “Ini peluang besar untuk dikerjakan para UMKM,” kata Dewi saat dihubungi MNC Portal Indonesia di Jakarta kemarin.

P

Dia bercerita, upaya untuk mengekspor batik Jawa Barat mulai dilakukan sejak awal tahun ini. Berkat basis komunitas yang kuat, dirinya dikenalkan kepada pemilik butik di AS dan gayung pun bersambut. Rencana konkret langsung dijalankan. Produk unggulan seperti tenun Baduy diharapkan jadi unggulan karena masih dikerjakan dengan tangan perajin. Cerita yang inspiratif di balik pembuatan batik selalu menarik minat pembeli di AS. Selain itu ada potensi lain, misalnya motif batik khas Cimahi seperti Ciawitali yang belum banyak diketahui. Lalu juga ada motif Megamendung dari Cirebon. Atau juga ada khas Garut. “Kita ingin ada imej seperti istilah baju Hawai buat ke pantai. Batik juga harus seperti itu, jangan terbatas pada adibusana formal saja. Karena di sana potensi UMKM masuk,” jelasnya. Setelah pihaknya melakukan kurasi berbagai produsen batik yang berminat, berikutnya langsung akan dilanjutkan dengan mengirimkan 50–100 produk ke AS. Beberapa pertimbangan dalam kurasi antara lain bahan katun yang nyaman dan kisaran harga dari Rp150.000 hingga Rp250.000.

Hasil penjualan awal ini akan dievaluasi untuk membaca selera pasar dan segera dilanjutkan mengirimkan volume lebih besar pada November tahun ini. “Kami ingin membangun komunitas UMKM yang sebenarnya. Tujuan besarnya untuk ekspor produk UMKM,” katanya. Menurut Dewi, banyak UMKM yang kena tipu janji-janji oknum atau yang menjual pelatihan mahal. Beberapa kasus barangnya ditolak di negara tujuan dengan berbagai alasan. “Kami bantu untuk foto produk atau layout para anggota. Untuk ekspor pembayaran akan beres sebelum barang dikirim. Ini murni business to business, bukan dikirim melalui negara ketiga,” tegasnya. Lebih jauh dia juga bercerita tantangan para UMKM dalam melakukan ekspor, yaitu kontinuitas pengiriman. Sering terjadi kualitas produk hanya bisa dijaga pada pengiriman pertama saja. Sementara pengiriman berikutnya mulai banyak yang tidak sesuai dengan perjanjian. Karena itu, menurutnya, sangat penting peran komunitas sebagai agregator yang tidak sekadar bisnis, tetapi juga melindungi pengusaha UMKM. “Sering kali UMKM lemah dalam

lobi-lobi bisnis, karena itu harus dirintis diplomasi bisnis. Jujur saja, UMKM Indonesia bisa kok sebagai seller langsung tanpa harus numpang lewat negara ketiga walaupun volumenya hanya satu dua kontainer. Kita harus ngobrol dengan negara tujuan ekspor, apa sih masalahnya,” lanjutnya. Di saat pandemi sekarang ini, menurutnya, peran komunitas sangat penting, termasuk bagi UMKM, agar bisa bertahan. Komunitas UMKM yang dibangunnya kini sudah semakin terbuka dari sebatas kumpulan para alumni Unpad dan sekarang merangkul pelaku usaha lainnya. Walaupun banyak komunitas bisnis, masih sedikit yang konsisten. Dalam komunitas seperti ini, menurutnya, harus mau saling menurunkan ego pribadi. Harus juga jangan saling banting-bantingan harga, tetapi harus berteman. Semuanya pasti saling membutuhkan. “Kami bahkan punya tiga WA group dan semua saling aktif berkolaborasi. Contohnya sekarang jelang puasa mereka sudah saling kombinasikan produk untuk bikin parsel. Produk batik bisa dijual paketan dengan bawang goreng atau madu. Kalau sudah begini saya selalu senyum sendiri, bahagia,” sebutnya. p ISTIMEWA

14

SENIN 22 MARET 2021

InFoRMASIA

Dewa Budjana Berkolaborasi dengan Musisi Dunia

Gitaris Dewa Budjana kembali menunjukkan produktivitasnya dengan merilis single ketiga berjudul Swarna Jingga dari materi album instrumental ke-12, “Naurora”, yang dirilis di tengah masa pandemi.

Pada karya single terbarunya kali ini, gitaris band GIGI ini mengajak tiga musikus jazz dunia, di antaranya adalah Dave Weckl (drum), Jimmy Johnson (bass), dan Mateus Asato (gitar). Di lagu ini, Dewa Budjana merefleksikan kondisi saat ini setelah pandemi berlangsung setahun lebih dalam sebuah karya instrumental. “Dulu kita melihat musisi asing itu kayak dunia yang enggak akan bisa disentuh, ternyata sekarang akhirnya saya bisa mengalami situasi itu. Bersyukur dan beruntung banget ada support dari (label) Mehsada akhirnya bisa ketemu,” ujar Dewa dalam keterangan tertulisnya. Sebuah eksperimen petualangan komposisi menjelajah dengan isian pas dari permainan gitar Dewa Budjana yang melibatkan sahabat musisi yang telah bekerja sama di proyek album sebelumnya. Nama-nama seperti drummer Dave Weckl, pemain bass Jimmy Johnson, dan asupan gitaris Mateus Asato menjadi karya terbaru diambil dari album “Naurora” yang rilis lewat label Mehsada, label rekaman yang menjadi bagian dari Kakiatna Indonesia Group. “Saya mencoba menghadirkan spektrum warna yang setelah Covid-19 berlalu nanti diharapkan kehidupan menjadi terang kembali. Jingga adalah bagian spektrum warna yang menguatkan kehidupan. Sama seperti kehidupan adalah emas, sesuatu yang berharga. Keberadaannya harus diapresiasi, termasuk kesempatan emas bisa

FOTO-FOTO : ISTIMEWA

berkolaborasi dengan Dave Weckl, Jimmy Johnson, dan Mateus Asato,” kata Dewa. Kolaborasinya dengan musisi ternama dunia dari berbagai negara dan usia ini dipilihnya karena masing-masing dari mereka sudah dikenal banyak orang dan ciri serta kemampuan bermusik yang tak perlu diragukan lagi. “Saya melibatkan musisi asing bukan karena dia bule saja. Kalau musisi bule saja mungkin di Bali banyak, tetapi kan yang harus punya nama dan pasti punya kemampuan,” kata suami dari Putu Borrawati ini. Dave Weckl merupakan seorang drummer paling inovatif dan musikal dunia yang selalu berkontribusi dalam industri dan pendidikan musik. Majalah Modern Drummer memasukkan Weckl ke dalam Hall of Fame mereka pada 2000, dan menamainya sebagai salah satu dari 25 drummer terbaik sepanjang masa. Pertimbangan inilah yang membuat Dewa memilih Weckl

sebagai drummer dalam lagu Swarna Jingga . “Walaupun saya enggak terlalu dengar banyak, tapi nama dia termasuk, seperti kalau di susunan pemerintahan, kayak menteri Dave Weckl, jadi harus. Kemarin pas dihubungi, dia dengan senang hati mau, walaupun rekamannya jarak jauh,” kata ayah dari I Desak Gede Mahavishnu Devananda dan I Desak Shakti Dawai Nanda. Dewa sebelumnya juga sudah pernah berkolaborasi dengan Jimmy Johnson. Ini merupakan proyek ketiganya bersama musisi jazz yang identik dengan 5-string Alembic bass. Sebagai solois, Jimmy Johnson dikenal sebagai musisi serbabisa, melodius, dan memiliki kemampuan yang hebat untuk menemukan harmoni. Pada posisi gitaris ada Mateus Asato, yang dikenal gitaris muda Brasil yang berbakat. Gitaris kelahiran Sumba Barat, 30 Agustus 1963, ini pun mengaku salut dengan eksistensi Mateus Asato meski usianya masih muda.

Saat diajak untuk berkolaborasi Mateus Asato mengaku senang dan antusias. “Unik ini, fenomena,

orang yang terkenal lewat media sosial dan memang memengaruhi banyak orang, anak muda

terutama, padahal enggak punya album tapi followers -nya kayak gitu. Mainnya memang bagus,” katanya. Adapun makna Swarna Jingga diambil dari tiga kata, swarna yang merupakan gabungan dari kata suara dan warna serta jingga yang artinya warna yang cerah. Ia berharap lagu ini bisa menjadi penghibur dan didengarkan saat dalam suasana hati senang. Perilisan single terbaru Dewa Budjana ini menghadirkan beberapa sahabat Dewa Budjana secara daring, di antaranya sutradara Mira Lesmana, budayawan Bre Redana, serta drummer Echa Soemantri. Dani Rahadian, CEO dari Mehsada berharap bahwa single “Swarna Jingga” Dewa Budjana bisa memberi sumbangsih energi saat masa sulit seperti saat ini. “Sebelum album penuh ëNauroraí rilis lewat Mehsada, kami berharap lagu Swarna Jingga bisa menjadi teman bagi banyak orang dalam kondisi yang susah ini dan bisa dinikmati lewat beragam layanan music streaming ,” katanya. Namun ada yang tak terduga, gitaris Mateus Asato setelah mengisi gitar di lagu Swarna Jingga ini menghilang dan menghapus akun instagram miliknya. Menurut laporan Guitar World gitaris ini break sejenak dari musik. Ada pun untuk video musik dari lagu Swarna Jingga juga telah tersedia di kanal YouTube Dewa Budjana official. Sebelumnya, Dewa Budjana sudah merilis dua lagu dari album “Naurora” yang berjudul Kmalasana dan Blue Mansion . Keseluruhan isi album tersebut bertemakan tentang warna. Setiap lagunya memiliki nuansa yang berbeda-beda. Kmalasana cenderung sedih, Blue Mansion yang lebih kompleks bahkan dikategorikan sebagai jazz, dan Swarna Jingga cocok untuk didengarkan dalam suasana gembira di tengah masa pandemi saat ini. pthomasmanggalla

Surga Yang Tak Dirindukan 3 Akan Ramaikan Momentum Ramadan Rumah produksi MD Pictures kembali menghadirkan karya film terbarunya berjudul Surga Yang Tak Dirindukan 3 . Fenomena mengenai poliandri menjadi isu yang diangkat dalam sekuel film kali ini. Surga Yang Tak Dirindukan waralaba sukses berbasis cerita karangan Asma Nadia. Saat kali pertama dirilis pada 15 Juli 2015 dengan bintang Laudya Cynthia Bella, Fedi Nuril, dan Raline Shah, film ini menyerap lebih dari 2 juta penonton dan menjadi film terlaris. Dua tahun kemudian, trio Fedi-Bella-Raline kembali dalam Surga Yang Tak Dirindukan 2 . Mereka didukung Reza Rahadian. Sekuel ini menyerap 1,6 juta penonton lebih. Menariknya, apabila dalam dua sekuel sebelumnya

ISTIMEWA

membahas mengenai poligami antara Pras dan Arini serta Meirose, kali ini kini dikemas menghadirkan isu poliandri di mana Meirose terjebak nostalgia masa lalu menjadi rebutan Pras dan sosok baru, Rey. Hanung Bramantyo, Coproduser yang menyutradarai film Surga Yang Tak Dirindukan 1 dan 2

menyatakan, tema out of the box mengenai poliandri ini menjadi tema yang menarik di kalangan anak milenial saat ini yang coba dikemas semenarik dan seringan mungkin agar pesannya sampai kepada penonton terutama dari kalangan milenial. “Kita bicara film tema ini untuk milenial. Mereka suka yang out of

the box cerita yang beragam, enggak melulu bicara tentang anak muda. Cerita orang menikah, ada pelakor, gosip twitter, istri simpanan, bahkan masalah pribadi Kaesang saja jadi viral di kalangan milenial,” ujar Hanung saat peluncuran trailer dan poster Surga Yang Tak Dirindukan 3 , beberapa waktu lalu. Aktor Fedi Nuril, pemeran Pras tokoh utama dalam film ini mengatakan, hal menarik dari Surga Yang Tak dirindukan 3 adalah posisinya terbalik. Ia kini ada di posisi Arini dulu dan di sini banyak kejutan dari Pras karena ada masa lalu yang muncul di hadapan Meirose, dan itu agak mengganggu hubungan pernikahan, dan di sini menunjukkan perjuangan kuat Pras sebagaimana Arini dulu kuat. pthomasmanggalla

Furnitur Lokal Unjuk Gigi di IFEX Virtual Expo Himpunan Industri Mebel dan Kerajinan Indonesia (HIMKI) dan Dyandra P‎romosindo baru saja menggelar pameran mebel bertajuk Indonesia Interna t ional Furnitur Expo (IFEX) Virtual Expo . Perhelatan ini merupakan pameran virtual perdana dari IFEX yang menampilkan 59 perusahaan dari sentra produksi mebel dan kerajinan yang tersebar di Indonesia. IFEX Virtual Expo merupakan wadah pameran yang memanfaatkan teknologi untuk tetap melaksanakan kegiatan bisnis furnitur dari Indonesia untuk dunia. Pameran yang telah diadakan pada 11-14 Maret 2021 ini dapat diakses oleh para buyers dari mana saja, baik dari domestik maupun mancanegara. IFEX Virtual Expo selama 4 hari tersebut telah diakses oleh 1.905 buyers dari 63 negara. Oleh karena itu untuk me-

menuhi kebutuhan bisnis industri ini, IFEX Virtual Expo diperpanjang hingga 31 Maret 2021. “Untuk menjawab kebutuhan bisnis, kami memutuskan memperpanjang penyelenggaraan IFEX Virtual Expo . Dengan banyaknya ragam produk Indonesia dari para exhibitors , tentunya tidak cukup dengan hanya 4 hari. Diharapkan perpanjangan waktu ini dapat menjaga optimisme dari para pelaku industri terhadap pemulihan ekonomi industri,” jelas Presiden Direktur Dyandra Promosindo Hendra Noor Saleh. IFEX Virtual Expo ini menampilkan produk-produk unggulan mebel dan kerajinan Indonesia yang bisa membantu meningkatkan kembali kegiatan ekspor industri mebel dan kerajinan lokal ke pasar global. Hal ini sejalan dengan arahan

Presiden Joko Widodo untuk menggencarkan pemakaian dan pembelian produk lokal. IFEX sendiri kerap menjadi acuan tren mebel dan kerajinan di lingkup regional yang masih menjadi perhatian buyers internasional. Apalagi di IFEX Virtual Expo lebih dari 1.000 buyers internasional mengakses platform dan berasal dari berbagai negara seperti Australia, Amerika Serikat, India, Spanyol, Singapura, Prancis, Yunani, Cina, Jepang, Belanda.

Masih tingginya minat pasar global terhadap produk Indonesia diharapkan dapat memulihkan kembali pertumbuhan ekspor industri mebel dan kerajinan lokal. “IFEX selalu ISTIMEWA menampilkan produkproduk unggulan khas Indonesia. Hal ini yang menjadi minat buyers internasional karena produk Indonesia memiliki desain yang unik dan etnis,” tutur Presidium HIMKI Abdul Sobur. Selain itu produk Indonesia juga dibuat dari bahan material yang khas dan kokoh seperti rotan dan kayu. Keunggulan produk lokal inilah yang diharapkan dapat menarik minat para buyers untuk mencari produk pilihannya. paprilia s andyna

Syaratt Pendaftaran S P d ft : 1. WNI Pria Dan Wanita ,bertaqwa terhadap Tuhan Yang Maha Esa. 2. Usia minimal 17 tahun 9 bulan dan maksimal 22 tahun pada saat pembukaan pendidikan. 3. Berkelakuan baik ,berbadan sehat. 4. Lulus SMA / MA IPA dan SMK Penerbangan jur Airframe Powerplant dan Avionics. 5. Belum pernah menikah. 6. Tinggi Badan minimal 163 cm diutamakan yang 165 cm untuk Pria dan 157 cm diutamakan 160 cm untuk Wanita. 7. Mendapatkan persetujuan orang tua / Wali. 8. Harus mengikuti dan lulus seleksi Administrasi, Skrining POM, Kesehatan Umum dan Jiwa, Kesamaptaan Jasmani, Litpers, Psikologi, dan Tes Potensi Akademik.

Pendaftaran mulai tanggal 8 Maret s/d 16 April 2021 Informasi lengkap di Subdisdiajurit Disminpers Mabes TNI Angkatan Udara Atau hubungi : 021 – 870 9390 / 870 9311 Website : https ://diajurit.tni.au.mil.id

15

SENIN 22 MARET 2021

SPortS

Misi Berbeda Piala Menpora

SOLO– Piala Menpora 2021 tidak sekadar turnamen pramusim. Selain menjadi tolok ukur kesiapan federasi dalam menggelar kompetisi di tengah pandemi Covid-19, ajang ini juga menjadi kesempatan mendapatkan pemain yang layak memperkuat tim nasional Indonesia di SEA Games.

Shin Tae-yong

Target tinggi kembali dibidik PSSI menghadapi SEA Games 2021 Hanoi. Pelatih Shin Tae-yong dibebankan untuk mengakhiri puasa medali emas tim Merah Putihyang terakhir kali diraih pada 1991 silam di Jakarta. Setelah itu Indonesia lebih banyak mengakhiri turnamen sebagai runner-up. Seperti dua tahun lalu di Filipina, skuad Garudakembali gagal membawa pulang medali emas setelah dikalahkan Vietnam di laga final. Kini harapan untuk mengakhiri kutukan runner upitu dilambungkan seiring dengan kedatangan pelatih kawakan asal Korea Selatan tersebut. Namun, persiapan skuad Garuda bisa dibilang jauh dari kata ideal. Meski sudah ada 36 pemain yang menjalani pemusatan latihan di Jakarta, namun hal tersebut tidak menjadi jaminan timnas Indonesia bisa tampil bagus. Penyebabnya, pemain yang dipanggil vakum menjalani kompetisi dalam satu tahun terakhir akibat pandemi Covid-19.

Hal itu berdampak pada kondisi fisik dan mental pemain. Kelemahan tersebut terekspose jelas pada dua laga uji coba menghadapi PS Tira Persikabo dan Bali United di sela menjalani pemusatan latihan. Shin Tae-yong sendiri masih memiliki waktu sekitar delapan bulan untuk menyusun skuadnya. Salah satunya dengan memanfaatkan ajang turnamen pramusim Piala Menpora untuk memantau pemain potensial untuk dipanggil mengikuti seleksi. Apalagi, ini menjadi kompetisi sepak bola satu-satunya yang digelar dalam waktu dekat mengingat Liga 1 dan Liga 2 direncanakan baru bergulir seusai Idul Fitri atau Juni. Di sisi lain, jadwal SEA Games semakin dekat. Sesuai jadwal, ajang olahraga multieventterbesar di Asia Tenggara itu akan digelar pada 21 November mendatang di Hanoi. Karena itu, meski sedang menjalani masa isolasi akibat terinfeksi Covid19, Shin Tae-yong wajib memanfaatkan Piala Menpora untuk mendapatkan pemain baru. Penekanan ini juga disampaikan Menteri Pemuda dan Olahraga Menpora RI Zainudin Amali. Dia menyatakan, turnamen yang bergulir mulai kemarin itu merupakan salah satu prasyarat dalam membentuk timnas persiapan SEA Games 2021. Pemain dari seluruh klub akan dipantau oleh Shin Tae-yong. “Saya yakin Piala Menpora ini kompetitif karena semua klub merekrut pemain terbaik termasuk pemain tim nasional yang dipersiapkan di SEA Games dikembalikan lagi ke klub-klub masing-masing. Mereka akan dipantau ulang untuk mendapatkan calon pemain terbaik,” katanya. Menpora menegaskan, pemerintah dan PSSI menargetkan timnas meraih medali emas. Untuk merealisasikan hal tersebut, timnas harus diperkuat pemain yang berkualitas dan siap mengingat pemain sudah tidak berkompetisi dalam satu tahun terakhir. Caranya dengan memantau materi-materi pemain yang tersebar di seluruh klub. “Optimisme saya itu berdasarkan pemantauan lapangan kemudian evaluasi dalam perjalanan saat mereka berada di Pelatnas dan kita akan lihat kualitas mereka pada turnamen pramusim dan

FOTO-FOTO:KEMENPORA

Duel Arema FC versus PS Tira Persikabo menjadi pertandingan pembuka turnamen Piala Menpora 2021 di Stadion Manahan Solo, kemarin. Menpora Zainudin Amali menyebut ajang ini menjadi kesempatan menyeleksi pemain untuk memperkuat timnas Indonesia persiapan SEA Games 2021.

kompetisi yang akan datang,” pungkasnya. Tidak hanya soal SEA Games, Piala Menpora 2021 juga menjadi role model untuk menggelar kompetisi di tengah pandemi Covid-19. Karena itu, isu penerapan protokol kesehatan menjadi prioritas utama selama berlangsungnya turnamen. Jika sukses, peluang menggelar Liga 1 dan Liga 2 pada Juni mendatang terbuka lebar. “Ini ujian bagi sepak bola Indonesia, kita harus mampu tunjukkan sepak bola bisa bergulir lagi dengan menjalankan protokol kesehatan yang disiplin. Saya yakin suporter Indonesia bisa tertib untuk mendukung Piala Menpora 2021 ini,” kata Menpora saat membuka turnamen kemarin. Untuk memastikan jika turnamen digelar sesuai protokol kesehatan yang ditetapkan BNPB dan Kementerian Kesehatan, Menpora sebelumnya mengecek secara langsung seluruh persiapan. Hasilnya, dia memastikan jika protokol yang diterapkan sama dengan uji coba timnas dengan Persikabo dan Bali United. “Apa yang dilakukan panitia saya kira sama dengan yang saya lihat di stadion madya ketika timnas main. Standarnya sama karena standar itu

yang kita jaga dan kita janjikan kepada pihak kepolisian,” katanya. Kemarin Piala Menpora 2021 dibuka dengan pertandingan antara Arema FC melawan Persikabo. Sesuai dengan arahan dari BNPB dan kepolisian, seluruh area Stadion Manahan Solo yang menjadi venuesteril dari penonton. Selain di Solo, tiga stadion lainnya yakni Stadion Si Jalak Harupat Bandung, Stadion Kanjuruhan Malang, dan Stadion Maguwoharjo Sleman juga menjadi tuan rumah. Ketua Umum PSSI Mochmad Iriawan juga menyatakan turnamen pramusim ini menjadi ujian untuk masa depan sepak bola Indonesia. Tidak hanya karena menjadi turnamen pertama yang digelar di tengah pandemi Covid-19, namun juga untuk menguji komitmen seluruh stakeholder mematuhi protokol kesehatan. “Kita tahu ada komitmen khusus dengan menerapkan protokol kesehatan secara ketat dalam setiap pertandingan. Saya yakin kegiatan ini bisa berjalan lancar dan sukses. Temanteman suporter nonton di rumah saja jangan datang ke stadion. Karena ini adalah ujian untuk kelanjutan sepak bola Indonesia,” tambahnya.  Dia menambahkan, turnamen ini

merupakan uji coba untuk melihat kesiapan pihak penyelenggara untuk menggelar pertandingan sepak bola di masa pandemi Covid-19. PSSI dan PT Liga Indonesia Baru memastikan turnamen ini akan memberlakukan protokol kesehatan yang ketat. Jika turnamen ini sukses, ada kemungkinan pemerintah akan memberi lampu hijau agar kompetisi Liga 1 dan Liga 2 digulirkan kembali.  Di sisi lain, Polri menyatakan tidak akan segan-segan untuk menghentikan pertandingan Piala Menpora jika terjadi pelanggaran protokol kesehatan. Tidak hanya itu, Polri juga menyiapkan sanksi tegas kepada penyelenggara. “Sudah menjadi komitmen semua pihak dan sesuai arahan Kapolri agar semua kegiatan keolahragaan digelar dengan protokol kesehatan,” ujar Kadiv Humas Polri Irjen Argo Yuwono. Polri menerapkan sejumlah syarat agar Piala Menpora bisa tetap berlangsung. Mulai dari pertandingan yang digelar tanpa penonton serta larangan ada penonton di area stadion, hingga membatasi jumlah ofisial maupun undangan di dalam stadion. pabriandi

Jalan Panjang Status Gender Aprilio Perkasa Manganang

“Saya Ingin Jadi Laki-Laki Sejati” ABRIANDI

Jakarta

enantian panjang Aprilia Santini Manganang, berakhir. Mantan atlet voli nasional itu akhirnya mendapat kejelasan mengenai status gender setelah menanti selama 28 tahun. Pengadilan Negeri Tondano memutuskan jika Manganang yang mempersembahkan tiga medali untuk timnas voli itu adalah laki-laki. Jumat (19/3), mungkin menjadi salah satu hari paling bersejarah bagi Manganang. Terhitung mulai hari itu, dia menyandang nama baru, Aprilio Perkasa Manganang. Nama itu disingkat menjadi Lanang dan menjadi panggilan sosok yang menjadi anggota TNI AD sejak 2016 tersebut. “Ini yang saya tunggu selama 28 tahun terakhir. Bersyukur bisa melewati ini semua dengan baik. Semoga ini menjadi awal yang baik bagi saya. Terima kasih kepada Kasad. Ini menjadi momen terindah dan saya akan melewatinya dengan hidup baru,” katanya sesaat setelah pembacaan putusan hakim secara virtual di Markas Besar TNI AD Jakarta. Sebelumnya, sosok kelahiran 27 April 1992 itu mengajukan gugatan perdata ke PN Tondano terkait perubahan status gender. Langkah itu dilakukan menyusul hasil pemeriksaan medis dan operasi yang dilakukan tim dokter Rumah Sakit Pusat Angkatan Darat (RSPAD) pada 13 Februari lalu. Pemeriksaan ini lantaran sejumlah petinggi TNI termasuk

P

Kepala Staf Angkatan Darat (Kasad) Jenderal Andika Perkasa menilai ada kejanggalan dari postur fisik Manganang. Dia kemudian diminta untuk datang ke Jakarta untuk dilakukan pemeriksaan menyeluruh. Hasilnya, tim dokter RSPAD menyimpulkan jika dia mengidap hipospadia. Kondisi medis ini menyebabkan saluran kencing tidak berada pada posisi yang seharusnya. Dikutip dari Halodoc, dalam kondisi normal, lubang uretra terletak tepat di ujung kelamin pria untuk mengeluarkan urine. Namun pada hipospadia, lubang uretra justru berada di bagian bawah. “Saya ingin menjadi laki-laki sejati dan bertanggung jawab,” ujar Manganang yang kini menyandang pangkat sersan dua kepada majelis hakim PN Tondano. Keputusan hakim PN Tondano ini tidak lepas dari kesaksian lima orang, masing-masing kedua orang tuanya, rekan satu angkatan di TNI AD, kemudian dua tim dokter RSPAD. Salah satu yang paling mencolok adalah karena Manganang harus menyesuaikan diri dengan pakaian perempuan lantaran bergabung sebagai anggota Kowad. “Saya tidak terbiasa memakai rok, tetapi karena tugas di Kowad akhirnya harus menyesuaikan diri dengan pakaian dinas. Biasanya pakai celana panjang. Tapi syukurlah semua sudah selesai,” ujarnya. Dia menambahkan, satu tahun terakhir adalah fase terberat dalam hidupnya. Situasi tak pasti terkait status gender membuatnya tertekan. Kehidupan dalam status sebagai perempuan membuatnya mengalami depresi. Hal ini dibenarkan dokter spesialis kejiwaan dr Bagus Sulistyo.

Dokter RSPAD itu menyatakan sudah melakukan wawancara secara mendalam selama empat jam untuk mengetahui kondisi kejiwaan Manangang. “Tekanan dengan status sebagai perempuan ini yang membuatnya depresi meskipun tidak diungkapkan. Dalam setahun terakhir dia menarik diri dari lingkungannya,” jelasnya. Nama Manganang bukan kali ini saja mengundang perhatian publik. Ketika memperkuat tim nasional voli Indonesia pada SEA Games 2015 Singapura, dia menjadi sorotan. Pada babak penyisihan grup, timnas Filipina mengajukan protes kepada penyelenggara lantaran menilai Aprilia seorang laki-laki. Protes ini cukup beralasan. Postur dan kekuatan smash-nya menyerupai pria. Tidak hanya itu, dia cenderung terlihat machodibanding rekanrekannya yang feminin. Namun protes itu dimentahkan penyelenggara dan memastikan bahwa Aprilia merupakan perempuan tulen. Indonesia akhirnya mengakhiri turnamen dengan medali perunggu. Itu merupakan persembahan medali kedua Manganang bagi tim Merah Putihsetelah pada 2013. Dua tahun kemudian di ajang yang sama, dia membawa pulang medali perak dari Kuala Lumpur, Malaysia. Prestasinya ini pula yang mengantarkannya bergabung dengan TNI Angkatan Darat. Lewat jalur atlet berprestasi, Manganang direkrut menjadi bintara pada 2016 dan bergabung sebagai Kowad dengan penempatan di Bandung. Dia kemudian dipindahkan ke provinsi asalnya di Manado, Sulawesi Utara. “TNI memutuskan merekrutnya

KORAN SINDO/ABRIANDI

Mantan pemain tim nasional voli putri Indonesia Aprilio Perkasa Manganang (tengah) didampingi Kepala Staf TNI AD Jenderal Andika Perkasa (kiri) saat mengikuti sidang Pengadilan Negeri Tondano secara virtual di Mabes TNI AD, Jumat (19/3).

lewat jalur rekrutmen khusus bintara berprestasi. Dia ditempatkan di bagian jasmani karena memiliki prestasi di bidang olahraga,” jelas Kasad Andika Perkasa yang turut mengikuti sidang virtual. Mantan Komandan Paspampres itu menjelaskan, pihaknya berinisiatif memeriksakan Manganang lantaran kondisi fisiknya berbeda dengan anggota Kowad yang lain. Hasil pemeriksaan MRI menunjukkan jika organ yang ada dominan menunjukkan laki-laki. Dia diketahui tidak pernah mengalami haid dan tak memiliki rahim. Selain itu, tes hormon menunjukkan bahwa kadar testosteron yang identik dengan lakilaki lebih tinggi. Karena itu, Andika kemudian menawarkan untuk

melakukan operasi, correction surgery. “Dia bukan transgenderjuga bukan interseks. Dia mengalami kelainan hipospadia, jadi tidak masuk dalam dua kategori tersebut. Dalam dunia medis, definisinya sangat jelas. Sudah menjalani operasi dan masih akan ada tindakan medis lanjutan,” tegasnya. Tidak hanya Aprilio Perkasa Manganang, Andika juga menyatakan memberikan bantuan serupa kepada kakaknya, Amasya Manganang yang juga mengidap kondisi medis serupa. Tim dokter RSPAD juga menemukan kasus media serius yang sama. “Dia curhat mau ikut diperiksa dan disiapkan tim dokter yang sama. Hasilnya memang sangat mirip dengan kasus adiknya,”

tambahnya. Kini, pria yang menyandang nama lengkap Aprilio Perkasa Manganang yang notabene merupakan pemberian Kasad, akan ditempatkan di bagian logistik yakni satuan perbekalan dan angkutan karena bakatnya dalam memasak. Andika menegaskan, dalam satuan, tugas memasak tidak hanya perempuan, namun juga pria. “Akan lebih terpakai potensinya kalau dia saya taruh di tempat yang lebih banyak ke hal-hal lapangan atau praktik. Misalnya, saya akan berpikir lebih pas bagi Lanang untuk ditempatkan di perbekalan dan angkutan. Di seksi perbekalan itu tugasnya antara lain menyiapkan makanan atau memasak,” pungkasnya.p

16

SENIN 22 MARET 2021

SPORTS

Jalur Empat Gelar Man City

LIVERPOOL- Memasuki bulan-bulan terakhir musim kompetisi 2020/ 2021, terlihat semakin besar kemungkinan Manchester City (Man City) mencatatkan sejarah baru di sepak bola Inggris. The Citizensberpeluang menjadi klub pertama yang bisa meraih empat gelar atau quadruple. Sejauh ini Man City masih berjuang di empat kompetisi, yakni Liga Primer, Piala Liga, Piala FA, dan Liga Champions. Peluang pertama Man City untuk mengangkat trofi musim ini tiba pada 25 April, ketika mereka menghadapi Tottenham di final Piala Liga. Namun, Kevin De Bruyne dkk mungkin sudah merebut satu gelar saat itu. Jelang jeda internasional, Man City memiliki keunggulan 14 poin atas rival sekota Manchester United (MU), peringkat kedua klasemen sementara Liga Primer (57 poin). Jika konsisten meraih hasil bagus selama beberapa minggu mendatang, Man City dapat dikukuhkan sebagai juara pada akhir April. Di Piala FA, The Citizens melaju ke semifinal seusai mengalahkan Everton 2-0 di babak perempat final, Minggu (21/3). Selain di pentas domestik, ada Liga Champions, di mana pasukan Pep Guardiola bersua Borussia Dortmund di perempat final. Terlepas dari performa impresif mereka musim ini, perlu dicatat bahwa Man City hanya berhasil lolos sekali dari perempat final dalam sejarah mereka, yakni ketika menembus semifinal Liga Champions 2015/16. Jika mereka mengalahkan Dortmund, maka Man City akan bertemu dengan raksasa Bundesliga, Bayern Muenchen, atau Paris Saint-Germain (PSG) di semifinal, yang mungkin menyajikan ujian terberat mereka dari tim-tim di sisa kompetisi.

Itu artinya, apabila Man City berhasil mencapai final Liga Champions pertama mereka pada 29 Mei dengan asumsi sudah mengamankan gelar Liga Primer, Piala Liga, dan Piala FA, maka mereka akan memiliki kesempatan menjadi klub Inggris pertama sepanjang sejarah yang meraih quadruple. Sejauh ini MU adalah satusatunya tim Inggris tersukses yang pernah menyelesaikan trebleLiga Primer, Piala FA, dan Liga Champions pada 1998/99. Ketika itu, The Red Devilshanya kehilangan Piala Liga. Dalam arti yang lebih luas, hanya satu tim Eropa, Glasgow Celtic pada musim 1967/68 yang pernah memenangkan Piala Eropa, liga domestik, dan dua kompetisi piala. Sedangkan dari Prancis, mengingat mereka memiliki dua kompetisi piala, PSG sering memiliki kesempatan menyelesaikan musim dengan quadruple, tetapi Les Parisiensselalu gagal melengkapinya dengan Liga Champions. Kendati berpeluang menciptakan sejarah dengan meraih quadruplemusim ini, Guardiola memilih menikmati semuanya setahap demi setahap, terutama pascamenang 2-0 atas Everton. Kemenangan Man City di babak perempat final Piala FA ditentukan lewat gol-gol dari Ilkay Gundogan (85) dan De Bruyne (90). Bersama Southampton yang menang 3-0 atas AFC Bournemouth, Man City kini tinggal menunggu dua tim lainnya di semifinal Piala, yakni antara

MESIN BARU MAN CITY

REUTERS

Chelsea versus Sheffield United dan Leicester melawan MU. Empat tim tersebut telah bertanding di babak perempat final malam dan dini hari tadi. Pelatih asal Spanyol tersebut mengatakan kesuksesan Man City memenangkan 25 kali dalam 26 pertandingan terakhir di semua kompetisi adalah berkat sebuah kinerja luar biasa dan profesionalisme dari para pemainnya meski belum memastikan apa pun. Sejak jeda internasional terakhir, dalam empat bulan The Citizenstelah memainkan 39 pertandingan; menang 34, kalah dua kali dan seri tiga. Sebanyak 23 pertandingan di antaranya dilakoni Man City dalam 79 hari nonstopsejak awal 2021. “Laju kami sejauh ini telah menjadi salah satu pencapaian terbesar yang telah kami lakukan bersama meskipun kami belum memenangkan satu pun trofi. Ini lebih dari luar biasa. Everton adalah pertandingan terberat yang kami mainkan sejak jeda internasional terakhir. Semua pemain luar biasa,” ungkap Guardiola, dilansir

dailymail. Kini Guardiola hanya berharap para pemainnya dapat kembali dari tugas internasional pekan ini tanpa mengalami cedera atau terinfeksi Covid-19. Meskipun kualifikasi Piala Dunia 2020 zona CONMEBOL telah dibatalkan, sebagian besar anggota skuad Man City sekarang akan pergi memperkuat negaranya masing-masing sebelum kembali melawan Leicester City pada lanjutan Liga Primer, 3 April mendatang. “Saya berharap para pemain bisa kembali dengan keadaan baik, bukan hanya untuk kami, tetapi juga untuk mereka. Kami sangat terkontrol dalam empat bulan ini, tetapi sekarang para pemain akan memperkuat negaranya,” terang Guardiola. Dari kubu Everton, tersingkir dari Piala FA membuat kans The Toffeesmeraih tiket kompetisi Eropa kini tinggal di Liga Primer. Mereka setidaknya harus finis di urutan kelima klasemen akhir untuk lolos ke fase grup Liga Europa. palimansyah

Pelatih Man City Pep Guardiola berhasil melakukan regenerasi di dalam tim dengan baik. Investasi yang dilakukan dalam dua musim terakhir mulai membuahkan hasil. Mereka kini bersinar dan siap menggantikan pendahulunya. GABRIEL JESUS Butuh waktu dan kesempatan untuk Gabriel Jesus membuktikan jika dia adalah pemain berkualitas. Di awal kedatangan, dia gagal bersaing dengan Sergio Aguero meski sempat “dipaksakan” oleh Guardiola untuk menjadi starter. Musim ini, dia mendapatkan berkah dari cedera dan kasus covid-19 yang menimpa Aguero. 2020/2021 Keterangan Gabriel Jesus vs Sergio Aguero Main 15 4 Gol 7 1 Assist 3 0 2019/2020 Keterangan Gabriel Jesus vs Sergio Aguero Main 21 18 14 16 Gol Assist 7 3 ILKAY GUNDOGAN Bergabung ke Man City sejak 2016 dari Borussia Dortmund, Gundongan akhirnya bisa memperlihatkan kenapa Guardiola bersabar menunggunya berkembang. Guardiola tetap memberikan kesempatan pada Gundogan yang sepertinya disiapkan untuk menggantikan posisi David Silva. 2020/2021 Keterangan Ilkay Gundogan vs David Silva Main 20 Gol 12 Assist 1 2019/2020 Keterangan Ilkay Gundogan vs David Silva Main 21 22 2 6 Gol Assist 1 10 PHIL FODEN Salah satu pemain akademi yang berhasil membuat Guardiola terkesima, demikian sebaliknya. Foden juga membuat Guardiola menjadikannya sebagai pemain tengah untuk disandingkan dengan pemain “asing” yang dibeli dengan harga tinggi. Dia bisa menjadi pengganti David Silva, Kevin de Bruyne, atau juga sebagai pesaing Bernardo Silva. 2020/2021 Keterangan Phil Foden vs Bernardo Silva 14 20 Main Gol 6 2 Assist 5 3 2019/2020 Keterangan Phil Foden vs Bernardo Silva Main 9 23 5 6 Gol Assist 2 7

Seharusnya Benzema Dipanggil Deschamps VIGO– Ambisi Real Madrid mempertahankan gelar LaLiga musim ini terus terjaga seusai menang 3-1 atas Celta de Vigo di Estadio Municipal de Balaidos, Sabtu (20/3). Keberadaan pemainpemain senior turut menjadi faktor konsistensi Los Blancos, salah satunya Karim Benzema dengan produktivitasnya. Benzema mencetak dua gol ke gawang Celta pada menit ke-20 dan ke-30, satu gol Madrid lainnya disumbangkan Marco Asensio (90+4). Dengan dua golnya atas Celta Vigo di Balaidos, Karim Benzema kini mengoleksi 186 gol di La Liga Santander. Dia telah menyamai rekor Carlos Santillana dalam daftar pencetak gol sepanjang masa Madrid di La Liga. Benzema hanya tertinggal dari Cristiano Ronaldo (312 gol), Raul Gonzalez (228), dan Alfredo di Stefano (216) yang berada di tiga besar pencetak gol terbanyak Madrid di La Liga. Ini adalah musim ke-12 Benzema bersama Madrid dan dia telah bermain dalam 373 pertandingan La Liga. Saat ini Benzema sedang dalam performa terbaik. Bomber asal Prancis tersebut telah mencetak gol di 6 pertandingan terakhirnya. Sepanjang musim ini Benzema memiliki 17 gol di La Liga dan total 23 gol di semua kompetisi. Ketajaman Benzema menuai apresiasi pelatih Zinedine Zidane. Meski mengaku heran kenapa pelatih Prancis Didier Deschamps tidak memanggilnya ke tim nasional Prancis. “Anda tidak dapat memahami bahwa Benzema tidak bermain untuk negaranya. Banyak orang tidak memahaminya. Tapi sebagai pelatih Madrid saya senang, Benzema melakukan pekerjaan yang bagus untuk tim,” kata Zidane seperti dilansir Marca. palimansyah